!Welcome to iNSANITY #2!Black Spyrit [iCE]AMany changes have taken place between our first release and issueAtwo, which includes many new people who have come over toAiNSANITY to help make it even better than before. Our seniorAstaff now consists of four members for this issue: Black Spyrit,APaladin, Zodact and Genesis. Our programmers are: Lord ofAPeasants and Kublai Khan. As far as other business, iNSANITY #1Aappeared almost totally as an "iCE" magazine, however we haveAdecided to steer somewhat away from that in an attempt to createAa more general pirate "elite" magazine, with more and better4articles, respected members and quality at its best.AAfter taking a basic poll over CelerityNET and other places, theAgeneral agreement was to stay with the text/ansi interface thatAwas found in issue #1. We had pondered over making the magazineAtotally VGA, but surprisingly enough most didn't like the idea!AAlso, I would personally like to mention and thank Osiris [iCE]8for the great VGA intro, it certainly turned out great!.AiNSANITY will now be coming out most likely on a monthly basis ifAall goes well and can be picked up at our current sites: Spyrit'sACrypt, The Paladium, BBS-A-Holic and The Support HQ. If youAwould like to help out with the magazine or "free-lance" anAarticle or two, contact any of the "senior staff" mentioned aboveAon the listed boards, or call the iNSANITY Home: Spyrit's Crypt[802] 879-1136.AWe hope you like issue 2, we want to be THE pirate magazine inAthe future, where all users can find quality information thatAthey trust and enjoy. If you have any suggestions, pleaseAcontact one of our members and let them know! Until next issue, later on... Black Spyrit=Letter from the ProgrammerLord of Peasants [iCE]A Welcome to issue #2 of iNSANITY! Who'd have guessed thatwe'd make it this far? hehe. A A lot of changes, both in the mag itself, and in the staffAof the mag since issue #1. Notably, the informal merger ofARadiant and iNSANITY. Hopefully good things will continue tohappen with the mag.A The "look" of the mag has changed very little since the lastAissue. Except for maybe the Vulcan Blood/Slime dripping. AAlso, the horizontal sensitivity of the mouse has been slowedAdown. A lot of people complained about not being able to use theAmouse properly because the tracking was too high. Hopefully,this should fix that problem.A The articles this month have all been run through a spell-Achecker, rather than doing it by hand (argh!) I think all of theAspelling errors have been caught, but if not...o'ell.. A lot ofApeople have told us to run the articles through a grammarAchecker. My experience with these programs is that theyAsometimes destroy the writer's "style", even if that style is nothaving immaculate grammar.A There are some notable additions this issue, also. ForAinstance, the Ware Report by Zodact (Caesar...) Also, the-Rumors will be a regular column in the mag. A We thank everyone who posted their comments and criticismsAto us about the mag. We attempted to address your suggestions asAmuch as possible in this issue. We also tried to stay away fromAthe 'iCE' idea in this issue and add as many articles asApossible. We're still looking for authors of regular columns orAfree-lance authors, though. If you have an idea for an articleAor column, contact one of the iNSANITY Staff members either on%Spyrit's Crypt or on one of the nets.A People have also told us to stick to the ANSi mag, ratherAthan go to VGA. That's fine with me! hehe. Doing a VGA magAwould mean totally rewriting the code, and I've been really busyAlately. In the future, we might fool with some VGA, but for theAnext few issues, you can expect it to be ANSi. Also look for8SoundBlaster/AdLib support in the next issue (hopefully)A Anyways, hope you enjoy this issue. Any comments can beAdirected to the Staff members on Spyrit's Crypt or on any of the9nets (CelerityNET and FelonyNET, if you wish to reach me), ...LoP...Some quick greets:2 Terror - Geez, where's that license?! " Zodact - Hail, Caesar! hehee$ Camber - Thanks for the help...; Osiris - Sweet loader, dude! Glad you're on our team.A Black Spyrit - What's a video page? Isn't that, like, in TheDraw?A New iNSANITY Members - Welcome to the team! Let's make our0 mag the best around.  V About [DnA] Opus OutlandA What is [DnA] you ask? Well, DnA Is the newest kind of groupA out there. No we're not another one of those ANSi/VGA GroupsA that comes and goes real quick. No we're not another crackingA group. No We're not a newsletter group. We're a music group.A DnA stands for Digital Noise Alliance which we are known forA our musical releases. Yes that's right..Music. We specializeA in making music for your enjoyment. We currently are workingA on Sound Blaster, Adlib, Roland MT-32, and MIDI equipment inA general. We have about 36+ releases already out. Some of theA file formats that cover these areas include : VOCs, ROLs, STMs,A MIDs, WRKs, and we are soon hoping to employ a few AMiGA usersA to make MODs for us. We have about 7 members at the moment whoA are usually working on a song or another release for us.A Because it takes so long to make a Release and we've only beenA around about 4 months I'd say we're doing quite good. We haveA sites over most of the United States and one in Canada. IA figure since we've been around for about 4 months now (Gee..A it went by so fast!) that we should release an article in aA newsletter telling you all the information you might not haveA known about this semi-new music group, [DnA]. First I wouldA like to start with a brief history of [DnA] and how it was founded. HISTORY -A After testing out the demo version of Scream Tracker on myA computer I decided to send away the money to register it.A Because of this, I received it a month later with a lot ofA fresh ideas on songs to make. (I had already mastered most ofA the commands of the program). And after only having theA registered version a few days, put forth my first songA (AggroMix.Stm). This really got me inspired and I decided toA start a group a few days later. I had remembered a group thatA mixed in Suzan Vega with a drum beat and really liked that. SoA I decided to honor them with the basis of the Acronym of DnA.A After a month or so of locally releasing songs, I met up withA the sysop of Inner City. If some of you don't know who that isA he goes by the handle of Father Time. He seemed to be theA first person interested in our songs and music and soon becameA my WHQ. Only a few short weeks after becoming a site he shutA his board down and I no longer had a WHQ. But he had given meA what I had needed to continue to help [DnA] to flourishA (Popularity). Because, not only were my songs beingA distributed locally but also across the state. Soon afterA accepting a few new members into the group I met up with TheA Silent Assassin. He really loved my stuff also and wanted toA become a site. Without hesitation he became my firstA International Site. Later I talked my friend (A local sysop)A Zyphril into becoming my World HeadQuarters and had requestsA from other BBSs. After choosing wisely I finally decided on these boards: High Voltage Chemical WarZone Digital Tension Paladium FLiPSiDE Helloween and these Members : DrZaphod Ace Dark Dementia Transfer Mind Flayer Roger Wilco Sound Wave Dr. IntoxicatedA Soon we had a little competition from another local group whoA got the Idea for a music group from us. They were called -aMp-A If I remember correctly that stood for Audio MusicA Professionals. They were the ones who drove us onward and keepA the releases flowing. Soon they died out and things started toA quiet down. After a few months of just wondering what to doA next, I thought since all these newsletter groups were around,A I would publish an article in one of them to get some moreA publicity for DnA. Anyways, that's all up to now. Look forA some of our great releases on the local Distribution Site nearA you. If you have any more questions concerning DnA or music onA the computer you can reach me on CelerityNET, SilicosisNET, LsdNET, or on one of my sites. Thanks For Reading! -- Opus Outland [DnA Founder]|Interview: Malignant GrowthScorchA Awe, the good ol' days of pirating. When men were men,Aand modems were afraid of them. Well, this little article is of6Ye Ol' Pirates of the Past, who are no longer with us.A For a lot of you older folks, who've been around theAblock a couple times, remember a lad by the name of MalignantAGrowth? Well, this particular article is of this once famedAmember of the 'rat community. Anyways, with no further adieu,heeerrrree's Vega.A*Note* Since I can't reach Malignant Growth, Vega 7 (who knows= him quite well) is taking his place as the guinea pig.Subject : Malignant GrowthInterviewee: Vega 7Interviewer: Scorch A+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++!1) How long has MG been pirating?A> MG has been pirating for many years. My best guess is that MG!> pirated for more than 5 years.2) When did MG start pirating?@> To my best knowledge, MG has been pirating since junior high.@> He first started pirating on an Apple //e computer along with@> his brother. He started pirating with the assistance of a@> friend whose handle is Cool Breeze (he's currently on Fungus@> Land). Cool Breeze was the one who showed him the ropes so to@> speak when he first started (ie - How to pirate wares, phreak,@> etc.). MG was pretty green back in those days. Cool Breeze@> sort of took him under his wings and showed him how and what@> to do. Cool Breeze and I met through Apple //e pirate@> boards. We both had Apple //e back in those days. After a@> while when Apple //e wares dried up, MG and I switched to IBM@> pirating (I actually took a slight detour with Apple //gs@> pirating - big mistake on my part) while Cool Breeze switched4> to MAC pirating. This happened about 4 years ago.#3) When/How was Fungus Land put up??> Hmm, Fungus Land was put up about 3-4 years ago when pirating?> was pretty small in the state of WA (ie - there weren't too?> many pirate boards back then in WA). MG saw a chance to jump?> into the market and did with Fungus Land BBS. Fungus Land?> was a joint venture so to speak. MG provided the BBS?> software, management, and contacts. Fist of Fury (the?> Co-Sysop of Fungus Land) provide the hardware (ie - computer,?> HD, etc.). I provided the HST modem that was needed to be?> considered an "elite" board. Back then, (about 3-4 years?> ago) the majority of the boards were 2400. Very few boards?> had 9600 HST. In order to be considered "elite", a HST was?> needed. I bought the HST to do Apple //gs pirating (because?> the //gs wares were huge in those days). After I quit the?> Apple //gs scene, MG asked me if I would loan the HST to?> him. Since I didn't have much use for the modem after I quit?> Apple //gs pirating, I decided to loan him the modem. The?> board was run from Fists of Fury's house since the majority?> of the hardware was his (MG was running the board via?> remote). Hehe, a lot of people didn't know this. When they?> paged the sysop, they thought they were talking to MG but in?> reality they were talking to Fists of Fury (in the few rare.> instances when he answered a page for chat).14) Did he have anything to do with Celerity/LSD? ?> MG helped in the design of both Celerity and LSD. I believe?> MG designed all the menus and stuff (ANSI) for Celerity and?> LSD. He had a lot of input for the authors regarding the/> look and feel of the two softwares I believe.=5) How did he get affiliated with INC? And the Other Groups??> I think MG, along with Line Noise, Warlord and a few others,?> were the founding members of INC. Warlord was a major?> supplier for INC back then and MG did a lot of work for INC.?> As for specifics, I really don't know since I wasn't an INC?> member. All the other groups (such as PSI), MG and Warlord?> started those after they got tired with INC (because INC was?> getting too big and too inefficient in cracking and?> distributing wares). Along with them, they took Bad Brains;> who was a major cracker back then for many pirate groups.6) Why did he quit from INC??> MG quit INC (from what I can remember) because INC was?> getting a little out of hand. INC was expanding too rapidly?> back then and it was getting too big and too INEFFICIENT in?> cracking and distributing wares. MG got tired of that and?> decided to quit to form smaller and more efficient group with?> Warlord as the major supplier. They took with them Bad?> Brains as one of their major crackers. There were a few?> others that quit INC to go with MG, but I don't remember who > they were.!7) When/Why did he quit modeming??> MG quit modeming after Fists of Fury took down the board?> (this was about 1-2 years ago). Fists of Fury took down the?> board because there was a bust back then and he feared that?> Fungus Land was a major target. Not wanting to take any?> chances, he decided to play it safe and take down the board.?> After he took down the board, he never put it back up again.?> It was at this point that MG faded from the pirate scene. I?> think MG, for a small time, tried to put up a board on his?> computer. But after a while, his HD broke down and he gave> up the effort.$8) What is he doing now? (Generally)?> To my best knowledge, MG is probably attending University of> Washington right now."9) Any last comments? (To anybody)$> Hmm, nope. No comments to anyone.>Greets: Vega 7 (See the famed Fungus Land (206)641-3238),> Honus Wagner, Genesis, Marshall Law, The Eel, Paladin.! `Interview: Crzy Joe Insane Fury- An interview with( CRZY JOE' NEUA VP( Q: How long have you been pirating for? A: 1 year 1 month' Q: How did you get involved with NEUA?) A: I liked their image, party on, drugs.+ Q: What position did you start at in NEUA? A: A proud Courier.. Q: How long before you became the VP of NEUA?A A: Actually I moved from Courier, to Courier Coordinator, to Vice Prez.@ Q: So whats up with NEUA, are they ever gonna make a big come back?A A: Ummmm, that's a hard one.. Ummm fuck ya we're commin4 back..No we're back, it rules, it fuckin rules.." Q: So how did you start modeming?A A: Like I saw an ad for compuserve and I thought, cool man, so I& went out and bought myself an HST.? Q: So what the hell do you do for fun, besides computer stuff?@ A: My first preference is smoking, second is pussy, third is" drugs, and then comes alcohol.A Q: Some people don't like the NEUA party till you drop image. What would you say to them? A: Fuck you all, get a Life!@ Q: Also, some people don't like the fact that most of your? releases are Educational Wares, what would you say to them?A A: I would tell them, don't drop out of school, stay in schoolA it's a good place to get beaver, plus education through piracy is important.A Q: You haven't been as active as you were in the past, what's up?@ A: What's up?, I'll tell you what's up, what's up is my phoneA bill, way up. Here's a little note to all of you out there,A if any of you want to donate to the Crzy Joe fund, Call3 Dimensional Juggernaut [604] and leave me mail.8 Q: What was the first game you ever couriered for NEUA?A A: It was Life and Death ][, and I sent it up to about 30% boards, which made an impression.@ Q: Whats the one thing you would want to say to all of the guys out there?A A: Well, to the couriers: You guys are the backbone of theA group, without you the pirate world would be nothing, keep up( the good work, whether big or small.- Q: What would you want to say to the groups?@ A: Well, to the groups, release quality wares, remember theA average joe pirate wants a game that works well, and not one" that is shit loaded with hype. Q: To the lamers?@ A: Oh shit, keep going at it, don't annoy the sysops, if you* really fuck up, go find another hobby. Q: To Novell?4 A: You guys are the greatest........at suckin dick. Q: To the SysOp of RED OCTOBER?A A: I hope you pull through this one, I also know what it's like2 being in deep shit with the big ass companies.A My interview with Crzy Joe was an interesting experience, IA found him to be a wise cracking fucked up muther. All I can sayA is take it easy and thanx a lot for the interview on such short notice.? Insane Fury '91?Interview: BelgarionPaladinA This is an interview I did with my good friend Belgarion,7 retired THG Member and Ex-SysOp of The Festering Pit.+ Q: How and why did you get into pirating?A "I got to talking with an individual in school about games, heA mentioned he got them from Pirate BBSes. I used to mess aroundA with a 300 baud modem in the Commodore 64 days, so I was reallyA interested. The individual gave me the numbers to some localA pirate boards and the rest is history. I guess I should4 include that the individual was you." (Gee Thanks) Q: How did you get into THG?A "I got to know Bam Bam, a THG Member, and I began courieringA games and stuff. After awhile he nominated me to be a memberA in the group. Everyone voted yes but Slavelord and Candyman, but I got in anyways." Q: What did you do in THG?A "I was the assistant to Fab Furlough, dealt with all theA Europeans, and basically did a lot of public relations. MyA board was the Courier Home for a while, and I told them whenA games came out and stuff. Also, I was the only THG Member thatA called out, and I tried to change the way people looked at THG./ Q: What did you like the most about pirating?A "I liked being known. I liked having power and prestige, andA everybody trying to kiss my butt. I also liked running aA board. I can safely say that my board was really good, I got) things fast and lots of people called.". Q: What did you dislike most about pirating?A "It's dishonest. Most people are rude, self centered, andA immature. I got sick of it. It also took too much of my time,A it became a full time job. I took it way to seriously. ItA hurt my social life, and my grades dropped." (Heh, I saw his report card): Q: Why did you retire from THG and take your board down?A "I re-evaluated my priorities, and decided that pirating was noA longer as important to me as I thought it was. I decided to* get out. I quit THG and sold my modem."> Q: Do you miss any aspect about pirating or regret quitting?A "Well, I had withdrawals for a little while, it was my life forA a long time. Now, I'm a different person, and don't regret itA at all. I still get the games from you, but I'm not even into@ games anymore. Everything's cool now." (I can vouch for that)= Q: What do you think will happen in the future of pirating?A "I think pirates will get younger and younger. From what I'veA heard, I don't know if THG will be the major power anymore, butA I've been out so long that I don't know what's going onA nowadays. I think when ISDN comes along, everything from BBS6 software to the whole pirate community will change."0How to set your v.42 HSTZodactAIt has come to my attention that there are many people out thereAthat still do not know how to set their modem for optimalAsettings. I have come up with settings that should guarantee youAtop transfer rates as well as allow any users to connect to yourmodem.AMany people do not know this, but some European countries use aAdifferent type of phone system. It is next to impossible toAconnect to your modem if they call from Europe if your modem doesAnot have the right options set. First of all it is mostAimportant to have ATB0 set. You will also want to have AT&G2 asAwell as ATS28=255 to make sure all people can connect as long asAthe line is good enough. If you do not have these settings onAyour modem then your answer tone will not be long enough fortheir modem to connect.AThe other settings are for flow control and compression. As longAas you set your modem to these settings it should give you hightransfer rates at all times.AHere is the text capture from my modem. If you set your modem toAmy settings you should have great transfers as well as be able to)let most Europeans connect to your board.A* Note: this is for the HST V.42 ASL modem. Most settings willA work on older models, but don't count on all of them.: For example AT&K3 and AT&A3 are for the V.42 ONLY!(USRobotics Courier 14400 HST Settings...! B0 C1 E1 F1 M1 Q0 V1 X1" BAUD=38400 PARITY=N WORDLEN=8 DIAL=TONE ON HOOK TIMER. &A3 &B1 &C1 &D2 &G2 &H1 &I0 &K3 &L00 &M4 &N0 &P0 &R2 &S0 &T5 &X1 &Y1 %R0 0 S00=000 S01=000 S02=043 S03=013 S04=010 0 S05=008 S06=001 S07=060 S08=002 S09=004 0 S10=020 S11=045 S12=050 S13=004 S14=001 0 S15=008 S16=000 S17=000 S18=000 S19=000 0 S20=000 S21=001 S22=017 S23=019 S24=150 0 S25=000 S26=000 S27=000 S28=255 S29=000 0 S30=000 S31=000 S32=001 S33=000 S34=000 ' S35=000 S36=000 S37=000 S38=000 News & Rumors of the SceneiNSANITY StaffA-----------------------------------------------------------------AUSA is a new group born with ex-members of THG and has joined#with the old Amiga group Fairlight.A-----------------------------------------------------------------AThe Humble Babe (ex-courier coordinator for THG) has changed hername to The NotSoHumble BabeA-----------------------------------------------------------------AGenesis has killed his old section called THG-DOX and formed thesupposed to get, including Willy Beamish and Police Quest III.A-----------------------------------------------------------------ARaDaR who is originally from the Amiga scene has offered INC someAinside originals in Virgin Mastertronic, although he was not the2one to supply last game from Virgin (Corporation).A-----------------------------------------------------------------ACandyman, the original founder of THG, has not returned but hasAcontacted the top members and given them orders to kick out overhalf their current members.A-----------------------------------------------------------------AThe Gestapo (an INC courier) took the hints to Willy Beamish that6USA had typed up and released them under the INC name.A-----------------------------------------------------------------AINC is desperately looking for any European contacts because all,the ones they have tried before have failed.A-----------------------------------------------------------------ARazor 1911 has been working closely with some old Amiga rivals7which may turn into future European contacts on the PC.A-----------------------------------------------------------------AThe Stalker (INC) quit the scene and took down his board, howeverAhe is occasionally sighted on some boards and recently supplied an original.A-----------------------------------------------------------------AINC members in the Dallas area are taking their boycottAseriously, they are rumored to be attempting to inflict seriousApenalties on people who disobey the rule: not to upload to anyDallas boards besides INC ones.A-----------------------------------------------------------------ATHG lost their consistent suppliers of the past. They are now4relying on ordering originals direct from companies.A-----------------------------------------------------------------ACYPHER is a hot new BBS program written by The Elemental. It is-going to give Celerity "a run for its money".A-----------------------------------------------------------------AThere is a new Razor 1911 board which is opened on a toll freeA800 number. Anyone in the continental U.S. can reach this boardlegally for free.A-----------------------------------------------------------------AMagnum (INC) and Cool Hand (INC) almost got into a fist fight$over a topless bar dancer in Dallas.A-----------------------------------------------------------------AEldar and Onyx, 2 of Germany's best crackers, have joined RazorA1911. They are the both among the few that are able to crack the@copylock protection as well as Sierra and Lucasfilm protections.A-----------------------------------------------------------------*THG has lost their old Microprose contact.A-----------------------------------------------------------------AUSA claims to be the group who is going to be the winner in thisholiday season.A-----------------------------------------------------------------AThis list is compiled by all the information collected by theAauthors of iNSANiTY. Submissions of information are always keptAconfidential because of the nature of some of them. Keep in mindAthese are only rumors, they are news that is given to us throughAvarious sources and we can not personally vouch for theirAvalidity. If you have any information you would like to have4published please contact iNSANITY at Spyrit's Crypt.9 -iNSANITY Staff7 About StackerPaladinA As most of you know, this program isn't new, but it seems thatA a lot of people don't really know what it's about, or if itA works well. I have recently heard all kinds of different prosA and cons to it, and many accounts of it working well forA people, and also it screwing things up and not working. I willA share with you my opinion and some info I have picked up from articles.A Basically, to start off, Stacker is a device driver with anA optional coprocessor board that stores data on your hard diskA in a compressed form. When you write something to your disk,A Stacker compresses the data before it's written. When you needA to access the data again, Stacker decompresses the informationA and lets you have it. So, it is said that Stacker "Doubles your hard drive space."A When you install Stacker, it creates a Stacker Volume,A compresses all your data currently on the hard drive, andA copies it over. You can set aside a certain amount of space onA the non-stacker volume that won't be touched by stacker, it'sA good to at least have a couple megs. Now, you should have$ close to twice the room available.A Now, Stacker performance. Well, there are two versions ofA Stacker, the software version and the coprocessor version withA software. Depending on what you do, Stacker will performA differently. With the coprocessor installed, it is said thatA reading and writing sequential information is faster than theA native hard disk, but when reading and writing randomA information, it is slower. So, with the coprocessor, theA performance seems to equal out, and seems to have little effectA on speed, yet doubles your hard drive space. With the softwareA version, it was benchmarked that it performed 18% slower thanA the coprocessor version, so, you get the doubled space, but+ with significant decrease in performance.A My own personal experience with Stacker was short lived. IA installed Stacker on my father's 286/12mhz with 2meg and triedA out various applications such as Windows, Excel, Word Perfect,A and some games. I didn't really notice a big difference inA performance. Speed in Windows wasn't really affected, but withA a 286, it's pig slow anyways. I did get double the space andA filled the whole thing up just to see. I got close to 80 megsA on a 44 meg. Not too bad. One thing I did notice was thatA copying from floppies to the Stacker Volume was SLOW. Like, 2A or 3 times slower, but, that's understandable because it has toA compress the new data. At my work, a guy with a 486 CADA station, installed it on a 40 meg drive, and he claims that it is faster.A So, basically, if you really need the space, and can't afford aA bigger hard drive, Stacker is the way to go. You will see someA loss of performance with the software only version, but the? with the coprocessor installed, performance shouldn't suffer.#Building your own computer (Part I)HyperionA If your current computer system was purchased completelyA assembled, it is likely that you overpaid by as much as 30%,A even if you purchased it through a mail-order company. When theA time comes to upgrade from that old, sluggish XT, or you wish toA purchase a second system, a savings of 10-40% can be achieved byA building it yourself. Savings are possible even by buying aA barebones system and upgrading it to your needs. This four partA series will guide you through building a system yourself. TheA series will discuss preparing to build your system, selectingA the components for your system, installation of the components,* and troubleshooting the finished product.A The first step in building a system is to identify what purposeA the system is intended for. Obviously, there is a greatA difference between the requirements of a network workstation orA bulletin board system and a system primarily used for CAD/CAM0 applications. A few general guidelines follow.; 1. Purchase the most powerful motherboard you can afford!A With todays high-performance application software andA even games beginning to require true 386 computingA speeds, you cannot go wrong purchasing a motherboard1 with more power than you currently need.8 2. Do not waste your money on an XT class motherboard.A With 286 motherboards falling below the $100 mark, youA will be better off purchasing a 286, even if you areA planning an inexpensive network workstation or bulletin board system.A 3. Avoid 16 MHz 386sx motherboards unless you are desperate to cut costs.A If a 386sx is the best motherboard in your price range,A you can get a 20 MHz 386sx for as little a $40 more than a 16 MHz board.A 4. If you buy a true 386, purchase a motherboard that is 25 MHz or faster.A Many mail-order companies are selling less expensive 16A MHz and 20 Mhz 386's, but these chips are no longerA being manufactured by Intel. If you purchase a 20 MHzA 386, you may run into trouble finding a replacement ifA the chip fails. The performance difference between a 20A MHz 386sx and a 20 Mhz 386 is so small, you are betterA off buying the sx and saving the extra cash for a better hard drive or VGA card.A 5. If you are planning a 33 MHz 386 machine, consider a 40 MHz instead.A Look around for a motherboard manufactured with the 40A MHz AMD chip. I have not found many bare motherboardsA with this chip, but if you find one, the cost isA typically about the same as 33 MHz boards with the IntelA chip. Six months ago I would have advised avoiding theA AMD processor, but they have proven to be reliable and? are now being used by many major system manufacturers.$ 6. Do not buy a 486sx motherboard.A You will get similar performance from a 40 MHz 386A motherboard at significantly less cost. Even theA performance difference between a 486sx and a 33 MHz 386: is small, and does not justify the extra expense.@ 7. If you decide to build a 486 system, buy a 33 MHz 486 motherboard.A 33 MHz 486 motherboards currently have the bestA price/performance ratio among the 486 processors. TheA performance of the 25 MHz 486 is significantly greaterA than the fastest 386, but motherboards with the 33 MHz> 486 processor can be found for only $100 - $200 more.@ 8. If you have your heart set on purchasing a 50 MHz 486.....WAIT!A If you just have to have the fastest Intel machineA available, wait a few months before you buy. As moreA companies begin manufacturing 50 MHz 486 motherboards,A the prices will drop greatly. If the price drop isA similar to the reductions on earlier processors, youA could save up to $500 by postponing your purchase for as little as 6 months.A To assist in your planning, I have compiled a chart to give anA approximate cost of your completed system. Costs areA 'guestimates' of current market prices; a smart shopper may be% able to build them slightly cheaper.AĿA Motherboard RAM Supply Cost AĴA 12 MHz 286 1Meg 200W $800 A 16 MHz 286 1Meg 200W $875 A 16 MHz 386sx 2Meg 200W $1050 A 20 MHz 386sx 2Meg 200W $1100 A 25 MHz 386 4Meg 250W $1350 A 33 MHz 386 4Meg 250W $1550 A 40 MHz 386 4Meg 250W $1550 A 20 MHz 486sx 4Meg 300W $1950 A 25 MHz 486 4Meg 300W $2350 A 33 MHz 486 4Meg 300W $2525 AA All system prices reflect average cost of motherboard, RAM,A standard VGA card, multi I/O card, drive controller, 1 floppyA drive, and one 80 meg IDE hard drive mounted in a standard desktop case.A As stated above, to protect your system from obsolescence, youA will want to purchase the most powerful system you can afford.A With many new software packages requiring 386+ computing power,A 286 and even 386sx machines will soon fall the way of the PC/XTA class machines, dwindling in usefulness and value. If a 286A machine is the fastest system your wallet will support, I wouldA strongly suggest waiting until you can afford a 386sx at theA minimum. Do not get me wrong, if you are planning to run aA bulletin board system, or simply building a machine forA occasional wordprocessing, etc., perhaps an inexpensive 286 isA the machine for you. For the majority of users, a 286 machineA will leave you wanting more....especially with the upcoming" release of Strike Commander! Next Issue:A What to look for when selecting your components, basicA guidelines to follow, and some great sources for inexpensive hardware.A I hope you enjoy this article, if it saves you some money, feel. free to send some of the savings to me! / ---=== םp ===---Tricks of the TradeBlack Spyrit [iCE]AThis months little "trick of the trade" revolves around a simpleADOS command. Unknown to many, this command can make life a lotAeasier on many people. The command is called SUBST. ThisAcommand allows a person to make any sub directory on his or herAhard drive act like another disk drive. What, you may ask, isAthe purpose of doing this? when a certain game or utility is;released and it is necessary to install it from floppies...AExample: Earl Weaver Baseball ][, this game requires you toAinstall it from a floppy drive, but forget that, you don't haveAthe time! So take SUBST and type: SUBST A: [Directory you wantAto use], and then unzip the game disks into A: and they will nowAbe on your hard drive. Just install it and the computer thinksAits reading the files from the floppy drive, simple as that!A(note: this is not guaranteed to work on all games, but will workin many situations for sure)Cracking Group ChartZodactAThis is the premier edition of a new cracking group charts thatAwill appear in iNSANITY monthly. The charts are made based on;the releases of all known cracking groups in the IBM scene.AI decided to write my own cracking charts because of the factAthat there was only one other chart in existance, the Byter'sAWare Report. I felt this wares report was not 100% accurateAbecause of many reasons. For one, he only counted the wares thatAwere uploaded to his system, Lexicon. If a smaller groupAreleased a game and did not get it on that system then theirArelease would not be counted in his chart. Another reason IApersonaly disliked his chart was because it counted everything aAgroup released. I feel their should be a separate chart thatAonly includes commercial games, not utilities, educational,Apublic domain, or non-English games. I have compiled my chartsAas fairly as possible. They will only include official releaseAversions of commercial games or complete final inside copies of"games to the best of my knowledge.ATake in mind this list is compiled from BBS file listings,$research, and my personal knowledge. ) [ September 1991 ]A.Rank Group Amount. ,1. INC 12,2. Razor 1911 11, COOP (TDT/TRSI) 11,3. USA/Fairlight 6,4. THG 5,5. NEUA 2, PE 2, Drunken Rom Group 2,6. FiRM 1, Skillion 1, XCP/VF 1AINC Western FrontLegend of C.Y.P.H.E.RPools of Darkness MegafortressDealer's ChoiceHare Raising HavokRiders of Rohan Home AloneRomance of Three Kingdoms IIShadow Sorceror Millenium Space Wrecked TOTAL: 12A RAZOR 1911 The Lost Admiral Western FrontConan the CimmerianThe Perfect GeneralNinja Gaiden IIAdventures of Robin Hood Home Alone Grail QuestTony LaRussa AL StadiumsTony LaRussa NL StadiumsEarl Weaver Baseball II TOTAL: 11ATDT/TRSI (COOP)Blues BrothersEngland Champion SpecialBattle CommandBrain ArtifaceBoston Bomb ClubWreckers Rescue at SeaMig-29 Super Fulcrum Eco-Phantoms Speedball II Killing Cloud TOTAL: 11AUSA/FLTMight and Magic III Leisure Suit Larry V (uncracked)Wordtris7 ColorsPolice Quest 3ImmortalTOTAL: 6ATHGF-117aMartian Memmorandum Gunship 2000 Dick Tracy 4D-Boxing 2.0TOTAL: 5ANEUAMicro League FootballRomance of Three Kingdoms IITOTAL: 2A Public Enemy Home Alone!Tony Larussa Best Teams data diskTOTAL: 2ADrunken Rom Group (DRG)Spirit of AdventureWild West AdventureTOTAL: 2AFiRMF-117a Final Sales VersionTOTAL: 1ASkillionBugabooTOTAL: 1AXCP/VFLeisure Suit Larry V (crack)DThe [ViP] StoryEinsteinA Well, our group started out as ViP. This stood for VictoriaA Independent Piracy. Yes, I know it started out with the citiesA name; I have a reason. When we started our magazine, we didA not know how well it was going to do, and indeed, the first oneA kind of sucked. It did, however, get us all sorts ofA recognition. Most people started saying "hey, they need someA experience, but they are doing well", and they also said "keepA up the good work." Some of the other magazines were commenting,A and we never really heard anything bad, except from a couple ofA local people (wouldn't you know it). Well, we decided that theA first issue didn't go too badly (modesty has never gotten meA anywhere). I guess that was when we decided that issue two should, and will, be released.A Our men, Shadow... and Kisanth, went to work on it, andA produced what appeared to be a far superior magazine than weA had seen in issue 1. Thank god! With better structure, and aA better menuing system (yah, I know it wasn't pull down) we wereA able to attract a lot more attention to ourselves. Gasp,A someone was actually interested in becoming a distribution site.A Well, in the past month, there have been some drastic changes.A As soon as we released issue #2, our prez Shadow... skippedA town 4 a vacation (the nerve). When he got back, he took hisA board down so that he could enjoy the rest of the summer.A Well, time waits for no man (or sysop), and things had to beA done. Kisanth got an HST for his board, and then I got mineA . Him and I started calling long distance, andA when we introduced ourselves to the other sysops, we wereA surprised how many people had actually heard of us, and our magazine.A I had a couple of requests for boards to become dist. sites.A Things got going very very quickly. Because Shadow... wasn'tA around, and attempts to find him were sort of in vain, KisanthA and I assumed control of the group. Call it a Coup d'etat ifA you will, but it amounts to the same thing. The crown wasA usurped by the second and third commanding officers. Our firstA order of business was to change the name. The old nameA included the name of our city. We did not like that, so we gotA rid of it. Because ViP was/is so widely used, we decided to goA with a completely different name. Kisanth, being allergic toA acronyms, said "No initials!". Hence, he came up with the nameA Litespeed. Reluctantly, I accepted it, but I did get to likeA it after a bit of exposure to it. We started collecting ideas,% and I started writing this article.A Well, things kind of got crazy from there; a few of the ViPA members did not like the idea of us changing the name and allA that, so they decided to start ViP, and basically told usA (Kisanth and myself) to go write our mag without them. Shit,A that's not what I wanted. So Kisanth and I started trying toA figure out whether we were going to produce our own mag, or tryA to get back into ViP. Well, the other people didn't knowA whether we should be let back in, and then Shadow... showedA up. At first, we were okay, but then a confusion came about,A and in a matter of a week, Kisanth was in and out about four times.A To make a long story long, Kisanth and Ninji decided to startA their new mag, with the help of Crzy Joe, and I didn't knowA what the fuck was going on. Was ViP alive or what? Shadow...A calls my board, leaves a public msg, and then *BOOM*. JustA like that, the ViP prez killed ViP. So hey, ViP is dead, mostA of the original members are starting a mag. All in all, I am! glad the way things turned out.]ViSiON-XThe Grim Reaper; ViSiON-X 0.90 Release Target Date October '91AViSiON came into problems around April '91 after the old ViSiONATeam was caught phreak/hacking, and lost their computers. ViSiONAlooked for a while as if it wouldn't survive the loss of theAauthor, but in Late July '91 ViSiON was picked up by the newAViSiON-X Team, with Warlord as the main programmer. The oldAsupport sites that were remaining from the ViSiON days were kepton.AThe ViSiON-X Team was able to recover the once thought lostAViSiON 0.83 Source Code, and picked up where ViSiON left off.AThe early ViSiON owed much to LSD, but decisions were made thatAmuch of ViSiON needed to be re-written to move away from the LSDAstyle, look, and programming routines. Less and less remains ofAwhat once was LSD 1.10. Full credit should be given to Slavelordfor the early ViSiON days tho.AA major ViSiON-X goal was to speed up it's current slow output.AMuch time was spent rewriting the way ViSiON handles it's ANSiAand Text routines. The Comm routines were entirely redone forAViSiON-X Release, and will shortly be added to current BetaAtesting. ViSiON-X will no longer use a Fossil Driver. InternalAANSi drivers will also be in final release. On release it willAbe as fast as Celerity. Check out a copy yourself. Speed will&depend on the type of machine you run.ACelerityNET compatibility has been added. So you could have theAHigh Quality FelonyNET (The current ViSiON-X Net) as well asACelerityNET at the same time. FelonyNET has a large INC Base,Aand Private Subs. With 25-30 Boards currently in FelonyNET, weAavg. around 150 posts a day. FelonyNET is aiming to have a MAXAof 40 Boards, and over time to weed out the best of the best 40Boards in the U.S.ATotally NEW Internal Menus done by a Member of ACiD will be addedAto release. I've seen 'em, and I plan to use them myself. Pretty cool.AMulti-Colored Quoting has been added, as well as numerous other*Bug fixes, and additions. Here are a few:A Speed increases User Side of 200%, and Sysop Local Logon speed increases of 600%( Global Local File Uploading for Sysop.A Global File Sorting, by Date, File Size, Filename, or File Description.A Option to add to batch as so: +1-20 to add files 1 thru 20 into2 batch, instead of doing them one by one by hand.A Titles bug fixed, and added so you can now do Titles while newscanning.A Jump to Another Conference Bugs fixed, and added to end of< Newscan, with immediate prompt to Newscan Next Conference.& You can now Net into Any Conference.% Entirely new Registration Routines. Over 12 New Config options.+ Rumors Displayed and Save [Y/n]? PromptedA Many many other Bug fixes, and additions that I won't go into here, as to save space.AViSiON-X will be under constant ongoing updates. It is now asAfast as Celerity, which was a major goal. We will be addingAkiller new features now that internally, ViSiON has come up toApar with the other major Forum hacks. These new features areAbeing kept quiet, so others don't steal ideas, as we've had probsAwith in the past. A goal has been set to pass up CelerityAcompletely in 4-6 Months as the BBS Pirate Software of choice.AViSiON-X aims to have more unique features and visual effects in,upcoming releases than any other Forum hack.ARelease will be out in a bit over a week. Get an Unregisteredcopy, and judge for yourself.3 Boards per Area Code Max.To see if you Qualify, contact:THE VOIDViSiON-X AlphaINC/iCE 313 981-3573 FelonyNETHardware/Utilities Release ListHyperionAThis article is intended to compliment the Capsule feature thatAClaude Rains has introduced to his Release files. Claude does anAunbelievable job keeping the BBS world abreast of upcoming gameAreleases. I hope to provide similar information concerning%future utility and hardware releases.AHardware releases are alphabetically organized by company.@Utility releases are alphabetically organized by software title.& New HardwareAAST Research is planning to release a high end server early nextAyear. The symmetrically multiprocessing server will support asAmany as 16 50 MHz 486 processors and a drive array systemAallowing use of up to 127 hard drives to near mainframe storage capacities.AChip & Technologies is introducing a "PC on a Chip" next month.AIt will incorporate system logic, power management control,Aserial and parallel port support, and a graphics controller on aAchip about the size of current processors. This chip will allowApalmtop PCs to run standard DOS applications. The chip is6expected to provide better performance than a 286 CPU.ADell Computer Corp. will be introducing 20 MHz 486sx that willAallow users to upgrade to a 33 MHz 486 by changing only the CPU./Future Intel processors will also be supported.AHewlet Packard will be shipping an upgrade to its LaserJet IIPAnext month. The IIP Plus will be nearly $50 less that theAstandard IIP and replace its 10 MHz Motorola CPU with a 16 MHz068000 CPU, reducing formatting time by up to 30%AOnce again, Intel is trying to make money on chips that failAquality assurance tests at high speeds. Intel is expected toAoffer a 12 MHz 486sx chip to OEM's next month. Compaq has!already declined a similar offer.AMicropolis Corp. is expected to ship its 2.4 Gigabyte, 5.25 inchAhard drive to OEM's this quarter. The drive will have an averageAseek time of 11 milliseconds, a mean time between failure ofA250,00 hours, and feature a built-in SCSI-2 controller. OEMevaluation price is $2495.ANEC has redesigned its Multisync monitors. The new monitors willAhave square, flat screens and are designed to work with VGA,A8514/4, and XGA video boards. The monitors will also feature anAAccuColor Control System allowing the user to adjust the digitalAcolors to match a color sample or a color reference guide. TheAfirst monitor to be introduced will be the 21-inch 6FG at a listprice of $3499.ASolid Computer is introducing a 650 megabyte rewritableAmagneto-optical drive with a 37ms average seek time. The drivesAcan be daisy-chained together as a DOS device to provide up toA4.5 gigabytes of storage. The Solidlaser will be prices startingAat $2850 and should be available next month. SunDisk Corp.Aintroduced a solid state storage system that weighs only 4Aounces, measures 2-by-3 inches, and stores up to 20 megabytes.0The system will run any DOS compatible software.ASymphony Labs has introduced a chipset that will allow OEM's toAmanufacture EISA based motherboards that will be comparably!priced to today's ISA-bus boards.ATandy Corp. will ship it new line of multimedia PCs this week.AThe new systems will include the Tandy CDR-1000 CD ROM drive andAan 8-bit audio card. Also included will be Windows 3.0 and%Microsoft's Multimedia Extensions 1.0ATeac is offering a new combination 3.5"-5.25" floppy drive. TheAdrive will read high density disks of both sizes and takes upAonly one 1/2 height drive slot. Initial offering will be to OEMsAonly at a price of $130. Teac is also introducing a 3.5" 128Amegabyte magneto optical drive with an average access time of 42(ms. Price is expected to be under $900.ATelebit Corp. has just released the T3000 v.32bis modem. TheAnew modem is reportedly supports sustained TRANSMISSION rates ofAup to 38.4 Kbps, with burst DTE speeds of up to 57.6 Kbps,according to Telebit.' New UtilitiesA386Max version 6.0 is expected to ship by the end of October.AThe new version offers a ROMsearch function similar to Qemm'sAStealth mode, but adds ROM caching for increased system speed.A6.0 can also remap VGA and EGA ROM into the monochrome region of-video memory, freeing additional high memory.ABorland C++ 3.0 for Windows has entered beta stage and should beAreleased late December. Version 3.0 is a completely rewrittenAcompiler and will support AT&T C++ 2.1 specifications. It will)support both DOS and Windows programming.AHarvard Graphics for Windows is expected to ship February 1992.AIt is expected to be easier to use, and yet more powerful than7the DOS based version, with strong data import support.AQuicken for Windows will be shipping in about a month. TheAwindows version will include a push-button toolbar, and Dynamic?Data Exchange links to 1-2-3 for Windows and Excel for Windows.ANetware-Lite, a peer-to-peer networking system by Novell, shouldAbe available by the time you read this article. Novell isAexpected to throw in a copy of DR-DOS 6.0 until the end of theAyear at no extra cost. At only $99, even the SPA wont be/breathing down our necks for pirating this one!AStanford Graphics is a Windows based presentation manager thatAwill feature a three dimensional spreadsheet with a 70 trillionAdatapoint capacity. Bubble, contour and surface plots, true 3DAbar charts, and probability charts supplement the charts found inother9presentation software. Release is expected in December.ASuper PC-Kwik version 4.1 (and PC-Kwik Powerpack 2.1) willAfeature a new utility called PowerWrite. PowerWrite will speedAdisk writing by more efficiently putting data on the disk,(allowing applications to execute faster.AWinSpeed is a software only solution for speeding up displayAperformance in Windows by 200 - 500%. It is scheduled forrelease on Oct. 15.AWordStar for Windows will offer keystroke compatibility withAWordStar 6.0 and will allow importing of more than 50 types ofAfiles, retaining the original formatting. A major drawback isAthe inability to open more that one document at a time. Releaseis expected late October.A Well, that is about it for now. If you enjoyed this article,Alet us know. If it is well received, look forward to it as aregular feature of iNSANiTY!* ---=== םp ===--- Greetz to:ABlacK SPyriT - Thanks for running a great board and letting meAknow about iNSANiTY. And to think I was asking you about writingfor that "other" mag!Lord of Peasants - Nice code!AClaude Rains - Thanks for your excellent release list! MaybeASOMEDAY I'll have the contacts to report releases a year inadvance....NOT! Ungreetz to:AThe Unknown User for including my board in your elite boardsAlist! Thanks for the advertisement, I'm sure you meant well, butAa list of elite boards is a dangerous idea. Please remove#Hyperion's Realm from future lists!DPiracyOptical IllusionA Have you ever decided to call out and then all of the sudden theA local loser board just makes your day by supplying you that gut( wrenching laugh you need to keep going?A Today I called a local board I noticed more than 20 someA messages of one raving fool telling another that Falcon 3.0 isA out. The second user replied, "No, Falcon 3.0 is not out".A Obviously, public loser number one could not resist so heA replied to the reply, "Sure it is man, you just send the companyA the money and they'll send you the game when it comes out".A Duh, no way? He doesn't notice the key words in the sentence are, 'when it comes out'.A This is the same local board where a Sysop expects people toA masturbate over the fact that he has over 4 gigabytes online andA 4 nodes. The problem is the userlist is jam packed with usersA that should have the words 'delete here' on their infoform. YouA really have to see some of these jokers. Some of them seem to( have the mentality of an aborted fetus.A For example, one day I came home from a friend's house aroundA 2:00 in the morning. I noticed that I had left the monitor onA before I had left and decided to go over and see who was on theA board before I went to sleep. Low and behold there was LineA Noise. I know Neil well and he does not call my board at 2:00A am. Just as I was about to go into chat and say, "Hey, Neil wuzA up?" I see that the user started to download some new files likeA the new version of Celerity etc. I decided to look at theA Caller I.D. I have hooked up to the board line and sure enough3 the caller hacking Line Noise's account was local.A After hanging up on the bastard I called him voice and broughtA the matter to his attention. After half an hour of denying thatA he called my system I said, "Listen guy, does my phone lie or doA you?". The aborted fetus said, "your phone isn't workingA properly". I then tried the threat tactic and told the guy IA would be at his house in 15 minutes if he didn't come clean. HeA then proceeded to admit the whole thing and I found out he was aA THG courier that goes by the handle, "Quick Silver".A Apparently, Line Noise's TELIX.FON was on a THG Private Sub andA Quick Silver couldn't hold back his excitement seeing as heA wouldn't have gotten access to any system if he applied as himself anyway.A What ever happened to the good old days where there were goodA boards and you knew which ones they were and the locals thatA didn't yet deserve access didn't get it and those that did hadA to wait to get their chance. I remember when I was considered a8 local loser by R.J. MacReady (remember Euphoria BBS?).A I would rather have those days back then be here now because itA seems what I have 'waited for' has not been worth the wait.A What ever happened to the legends of piracy where theA discussions made sense and where the users typed in fullA sentences? What happened to the users that knew where their1 caps lock key was and knew how to really use it?A The moral to this story is simply, let's forget the group warsA and start looking at who we really have on our systems. NotA only to avoid idiots but to protect ourselves from unwanted& outside agencies and software agents.A Quickie opinions: Hardware is nice but it doesn't make a BBS alone.A The Toronto Blue Jays are going to win the World Series.DANSi Groups...What's the point? Kingpin [iCE]A Over the last 6 or so months, there have been manyA developments of new ANSi groups tearing in and out of the PCA scene. When they are first developed they will gain praise forA maybe one day, and then they will fade out of the woodwork andA leave a bad mark to the true ANSi group(s). This article willA delve into some of these groups which are functioning and someA which are dead, and hopefully give you second thoughts beforeA starting one of your own. Some groups used as examples will be TNT, RPM, and STRiKE.A The first example being TNT, is still alive but theyA are not turning out anything. This group was formed from theA remainder of STRiKE after its demise. Frankly, they suck. IA have NEVER seen one good ANSi ever by any member, except forA one which was partially stolen from one of my older efforts.A This is a great example of my opinion on the subject. TNTA created an empire of distribution sites and such but neverA turned out anything, they accepted members who could not drawA much better than the average modemer, they put their sorry nameA all over the scene in a series of disgusting advertisementsA (and are still doing so). These ADVERTISEMENTS andA distribution sites which put TNT all over everything should beA dragged off and shot. How many times have you seen this drivelA on a network such as CelerityNET or VelocityNET? CountlessA times no doubt... I'm sure they know they suck. If you are* reading this TNT, GIVE IT UP you suck!!!A RPM is also an example to learn from, RPM is definitelyA more of a serious effort than TNT, but it still has manyA shortcomings. RPM has turned out some very good artwork, butA the total CRAP of the group far outweighs some good artwork byA a couple members. Notably, Martial Law for ANSi (incidentallyA now in iCE), and Revelation for VGA were their best artists. IA believe they had many more as well which were all either totalA shit, or partial shit. That is where the problem starts, tooA many members, and too many distribution sites. With the largeA number of distribution sites, the RPM name will get spread allA over the place when they produce next to nothing. This isA irritating as hell, I can't stand to look at all of thoseA distribution sites, which advertise RPM, and have nothing onA them. Also, the public image of RPM in the beginning wasA helped by some "big namers" who supported the group. This isA also a crime, people judge the group by big names who don'tA even do anything, and don't produce any art. RPM can be savedA however if they kick out all of their shit artists and aboutA half of their distribution sites. Otherwise they grew too big) for the artwork which they can produce.A STRiKE, now this was a OK effort. I myself was a partA of this group. The quantity of artwork was not the problem,A the quality was. STRiKE like many other lamer ANSi groupsA released TONS of total SHIT and maybe for every 5 shit releasesA they put out 1 good artwork. The large amount of work is greatA for distribution sites, I had over fifty files in a VERY shortA period of time, but the artwork was horrible. Fortunately,A STRiKE did not advertise all over the place and become a bigA irritation like TNT and RPM, however they still did this to some degree.A The moral of this story? Don't make your own ANSiA group. If you belong in one, try and join one of the alreadyA established ones, and if you are turned down, do not make yourA own. Let's face it, if you can't make it into a group like RPMA with your efforts, you suck. I for one am sick and tired ofA looking at all of these lamer group adds, and I am sure manyA others are as well. Do us all a favor, go out and buy a1 coloring book or paint by numbers and have fun.What's up with iCE?Black Spyrit [iCE]A A lot has been happening lately with iCE, a lot of rumorsAand tales going around. Basically to sum it up, Frozen TormentorAhas dropped out of iCE and sold his modem. This means that BlackASpyrit (me) is now the president of iCE. Along with FrozenATormentor went his board, Banished Corosive Poison, the ex-iCE7WHQ, which means Spyrit's Crypt is now the new iCE WHQ.A As far as distribution sites, a few new ones have beenAadded and some re-organization has occurred. The new sites areAas follows: BBS-A-Holic, The Paladium, and House of The RisingASun, look for all the new ansi's and vga's from iCE to appearAthere now. If you were one of the boards replaced, there is aA95% chance it was because either your board sucked or didn't helpApromote the group in any way, but there is a small chance I justAforgot you... if this is so please let me know so we can work itout.A Other than that, the only new things that are happeningAare the recent addition (a fine one at that) of Marshal Law toAthe group who has been turning out some great things recently.AWe are in the process of looking for some good vga artists asAwell so look for some more great iCE works in the future.AAnother new addition has been Osiris, both as programmer andAbeginning VGA artist. He was responsible for creating theAiNSANITY loader at the start up of this mag, so look for some+great things coming from him really soon...$#The Official Story on USA/FairlightGenesisA On September 12, 1991, a new crack group was formed - USA.A From the moment the idea of this group was conceived to theA moment when we put out our first release took around twelveA hours. In this short time span a lot of phone calls were madeA while members, dist sites and couriers were inducted,A strategies were planned, a management staff was formed, andA the USA name was created. USA stands for United SoftwareA Association. It is a totally generic group name, we agree,A but when we formed USA in this short time we already had aA release in hand and wanted to get it out quickly, so we didn'tA spend a whole hell of a lot of time thinking about what toA call ourselves. Plus we liked the catchy three letter comboA of USA so we went with it. The "USA" title just has a way ofA growing on you, so even if you don't like it now, give it someA time, you will get used to it. I think we spent all of aboutA a half hour on deciding the group name and spent the rest ofA the twelve hours on more productive things. The name of aA group isn't what makes the group anyway, it's what the group6 releases that counts, as I'm sure you'll all agree.A USA's senior staff consists of The NotSoHumble Babe, Silencer,A and myself. There is no president or dictator in this group.A There are just three senior staff members who all consult oneA another and reach an agreement before making any decisions.A The primary organizer of USA is The NSH Babe, formerly knownA as The Humble Babe. The NSH Babe had been with THG for quiteA a long time and I won't go into details, but as a result ofA some conflicts of interest within THG, The Humble Babe andA about 10-15 other members, member boards and distributionA sites were removed from THG. Why did THG drop so many peopleA at once? I really don't know the TRUE reasoning behind thisA decision, but I will not speculate on the rumors I haveA heard. It happened, and that's that as far as I amA concerned. But, whether it was justified or not, I did notA find it too cool the way the situation was handled. This,A coupled with other factors led me, a few others and most of) the couriers to quit THG and join USA.A When deciding to join USA in the early hours of the birth ofA the group, I saw that they already had a top-notch list ofA members and boards behind them, and a great amount of ambitionA and determination to become one of the best. I was offered aA Senior Staff member position in the group, and since I had aA lot of experience and ideas which I felt could be used to helpA USA excel in their endeavors I felt that this would be a greatA opportunity to get involved. The challenge of starting aA crack group from the ground floor and making it a realityA appealed to me. It would be hard work, but with the effortsA of our talented and diversified list of members I knew we could go far.A As it turned out, there was a Euro Amiga Group trying to breakA into the American PC Scene about the same time as USA wasA forming. This group is known as Fairlight, and its founderA and president is Strider. We hooked up with Fairlight and weA are basically acting as Fairlight's PC Division, but with anA identity and management staff that is all our own. StriderA will be supplying us with Euro-PC originals once in awhile,A and trying to set up more PC contacts for us in Europe.A Strider has already come through with a couple of games forA us, 7 Colors and The Immortal, and is working on many more.A Fairlight has been around for many years and Strider startedA it back in the old C-64 days. It is a group that has beenA going strong on the C-64 and Amiga scene for quite some timeA now, and should be doing well on the PC scene once things get set up.A USA's first release was Spellcasting 2o1 Beta. We got a lotA of feedback about this ware, some good and some bad. TheA pirate world seems to be divided 50/50 when it comes toA betas. About half of the comments we received were pro-beta,A the other half were anti-beta. We don't really see a problemA with releasing beta wares. We make every effort to depict theA ware as being a beta, such as with the Spellcasting release weA put a B in every filename, we put a BETA in every fileA description, we named the .nfo file S201BETA, and we wrote aA paragraph of explanation in the nfo file as well. This wasn'tA enough for some people, apparently, because once the wareA started getting spread by non-USA couriers, some peopleA uploaded it without putting BETA in the file descriptions andA this pissed a few people off after downloading it, thinking itA was a release and then finding out it was only a beta. All IA can say is that we have nothing to hide, we went out of ourA way to show everyone that S2o1 was Beta, and those who do notA pay attention to filenames or take a brief moment to do a zip6 view on a file shouldn't feel like they were duped.A USA's second release was some documentation for SpellcastingA 2o1 Beta, and our third release was a Demo of the latestA upcoming SSI game, Shadow Sorcerer. I think it's interestingA to see a sneak preview of a new and long-awaited game via aA demo and I especially like playable demos. A lot of times weA get demos of wares we are expecting to put out so we'll putA the demo out to give people an idea of what the game will beA like. This way people can decide whether or not it will beA worth their time to download the game when it does come out.A Not many other groups seem too interested in putting demosA out, perhaps they think it's lame or cheezy. But we're goingA to try it for awhile and if we get a good response we'll= continue, a bad response and we'll quit putting demos out.A Our fourth release was our first major release - Might AndA Magic ]I[. We got off to a slow start with a beta and a demo,A and I'm sure a lot of you said "Shit, I bet betas and demosA are the best they can do." Well if you were one of thoseA people I'm sure the MM3 release was quite a pleasant surpriseA for you. We enjoyed putting it out and by doing so, hopefullyA we proved ourselves to the pirate world that we are not someA fly-by-night organization. And if that didn't convince youA well then I'm sure the next release, Leisure Suit Larry 5A did. This has been one of our largest and most popularA release to date, but still, the fact that we released it# uncracked caused a few problems.A The problem with Larry 5 is that it had one of the mostA difficult copy protection schemes ever put into a game.A Sierra has a notorious reputation for making difficult toA crack copy protection, and this release was no exception.A We've heard that practically every major group, INC, THG, PEA and TRSI/TDT were trying to crack this and no one was able toA until 4 or 5 days later when this dude Eldar from VisionA Factory put out a nice little crack for the game. I'd like toA congratulate Eldar, by the way, for his excellent work on thatA crack. It was really a great achievement and earned him someA well-deserved recognition. We would have liked to have him onA our team but he was recently picked up by Razor 1911, IA believe. In any case I think he's a great cracker and I wish< him luck in his endeavors with whatever group he chooses.A In the meantime while everyone was waiting on a crack, SCD-DoXA put out some scanned doc check codes for Larry 5 which enabledA most people to play the game through. Most people realizeA that Sierra copy protection is a total bitch to crack, andA have been quite understanding of why we put it out uncracked.A A few people made a big stink over the uncracked Larry 5, butA they didn't know any better. No group will sit on a ware forA 4 or 5 days trying to crack it, while knowing some other groupA is just going to put it out uncracked anyway. With a game asA large as Larry 5 it takes 4 or 5 days to get thoroughA distribution anyway, so what is the point of waiting. We'reA better off getting the ware out to the public, getting creditA for the release, and then working on the crack. If you don'tA agree with that, well I don't know what to tell you, exceptA that's the way it is and has been for quite awhile. We'reA just playing by the same rules that have been established forA years, and that's, 'He who gets it out first wins'. If aA group would hold a game like LSL5 for 4 days while crackingA it, or release a game like LSL5 right away, but uncracked,A then put out a crack 4 days later, what is the difference?A You get the cracked game at the same time either way, don'tA you? At least in the case of a huge Sierra game like LSL5A being put out right away, you at least have time to downloadA it and distribute it while waiting for the crack to be put out. It makes sense.A We followed Larry 5 with some dox and hint releases, thenA Wordtris, then a couple of Euro games, 7 Colors and TheA Immortal. Then we put out some more pretty huge games, PoliceA Quest 3 and Willy Beamish. Police Quest 3's protection wasA integrated as part of the game play, and made it notA worthwhile to crack, for to do so would probably ruin the wayA the game was intended to be played. Willy Beamish had a docA check at the near-end of the game. Fortunately we were ableA to put out a patch for it before anyone even discovered theA doc check. It seems that these game companies, especiallyA Sierra and Dynamix are getting more and more clever with theirA copy protection schemes with each new release. People areA going to have to learn to be a bit more understanding withA crack groups due to these increasingly difficult copyA protection schemes. Sometimes these games will have to beA fixed, or won't be able to be cracked at all, but you can beA sure the games will be followed up with some form ofA documentation to get you past the protection. Hey, it's freeA software, so why bitch about it? Crack groups do their best,A and are only human, and we should respect and understandA that. There's one thing you can count on, though, we have 3A very experienced and well-known crackers in USA: R. BubbaA Magillicutty, Lord Blix and Harry Lime. When we releaseA games, they go to our crackers first, and if it's not someA crazy Sierra protection or a doc check at the end of the game,A the ware will be cracked before we put it out. We'veA successfully cracked every non-Sierra game we've put out, so, cracking is not a problem for this group.A Well that's about it as far as what we've put out since USAA was created less than a month ago. For being around for suchA a short time we think we've done pretty well, and we'll hope you agree.A Another thing about USA is that we won't knowingly orA intentionally double release another groups ware. There haveA been a few instances where we have received our copy of a gameA only a few hours after another group had released their ownA version of the ware. The two times I can recall thisA happening were with Millennium 22oo and Corporation U.S.A Version. When we get a new ware we check a few of the topA boards to make sure it has not been released yet. If it hasA been released we will not double release it. We will justA settle for putting out the dox instead, as we did with both ofA these wares. We just feel it's pointless to double releaseA another group, and we wouldn't want another group doing it to/ us, so we try our best to avoid such things.A I'd like to introduce all of our members to you now andA explain what we all do at USA/FLT. The members of USA/FLT are0 grouped into four classifications as follows: USA Senior Staff Members ~~~~~~~~~~~~~~~~~~~~~~~~A The Senior Staff Members basically do a little bit ofA everything from supplying new wares to helping couriering theA wares to our dist sites. Senior Staff has many, many dutiesA and responsibilities, and oversees the release of a new wareA from beginning to end. We are basically all on the same levelA of power, and we are all "in charge" of the group. There isA no president or ruler of the group. The senior staff membersA all try to discuss things together and make joint decisionsA together on all things which affect the group. The basicA premise of USA is "group effort" so we all work togetherA towards common goals. The Senior Staff Members consist of the following people:A The NotSoHumble Babe - Organizer of Dist Sites, Members,. Wares, Supplies.? Silencer - Organizer, Packages, Liaison on Euro contacts.@ Genesis - Organizer, Editor and Chief of USA-DoX, Packages, Supplies.8 Strider - Prez of Fairlight, Euro contact/supplier. USA Regular Staff Members ~~~~~~~~~~~~~~~~~~~~~~~~~A The regular staff members are actually by no means "regular"A or "ordinary". They are the backbone of the group; fromA suppliers, to crackers, these members do a great deal to helpA make it all happen. Without these guys, USA wouldn't be much of a group at all: Lord Blix - Cracker Suicidal - Head of Couriers Harry Lime - Cracker Static - Organizer2 The Necromancer - Loader coder, USA-DoX Scanner" R. Bubba Magillicutty - Cracker Mad Gib - Supplier The Guch - Coder Lord Sterling - Supplier Snuggles - Supplier USA-DoX Team ~~~~~~~~~~~~A The USA-DoX Team members supply, type, scan, and create doxA and solves for our games as well as others. These guys helpA make the pirate ware experience complete with full dox and$ solves for your reading pleasure:A Genesis - USA-DoX Team Chief Editor, Supplier, Packager, Coordinator" The Necromancer - Scanner/Typer% Repo Man - Scanner/Typer, Supplier+ FAThead - Game Solver and QwikDox writer Current Couriers ~~~~~~~~~~~~~~~~A Couriers are the unsung heroes of the pirate community. TheseA are all of our current couriers responsible for spreading ourA releases to our dist sites and member boards and beyond.7 Without these guys, USA wares wouldn't get very far:8 Morpheus, The Bartender, Crime Slave, Snuggles,6 Dr. Crippen, Heavy Metal, Live Wire and CrossA We've received a great public response to our new group andA have been getting many membership, courier and dist siteA applications. We are being picky about who we select to be aA part of our group, ensuring that only the very best people areA accepted into our family. We are not interested in being theA biggest group, we just want to be one of the best. If youA feel you have something to offer to our group, as a courier,A supplier, or cracker, then give our VMB a call or contact oneA of the Senior Staff Members via CelerityNet. We are always onA the lookout for talented and dedicated individuals who are interested in joining us.A I hope you will appreciate my openness and honesty in thisA article. Perhaps the article is a bit lengthy, but at leastA now you know who we are, what we do and how we do it. It'sA USA's belief in an open-door type policy and being in touchA with the pirate community that has allowed me to be soA forthright in this article. With'iNSANITY CommandsLord of Peasants [iCE]A You don't have to be a rocket scientist to figure out how toAuse iNSANiTY, but I figured I might as well post the commands youuse.= Note that iNSANiTY has mouse support. Cool, eh? PULL-DOWN MENUS( Left/Right Arrow / Left/Right Mouse : . Move between the different main headings." Up/Down Arrow / Up/Down Mouse : 0 Move between the choices in a menu heading.% [ENTER] / Left/Right Mouse Button : Select a menu choice. Esc : Quit from iNSANiTY.ARTICLE VIEWER! Down/Right Arrow / Down Mouse :) Scroll down one line of the article. Up/Left Arrow / Up Mouse :' Scroll up one line of the article. PgDn / PgUp :1 Move down/up one full screen of the article. Home / End :, Go to the beginning/end of the article.! Esc / Left/Right Mouse Button :# Return to the pull-down menus.A                   ۱   ۱     ۲   ۲    ݰ ݰ  ݰ               ݰ ݰ  ݰ                      .     .  . .8   . . .   Insane Creator Enterprises .  . 6.  S PY RIT'S CRYPT [WHQ ]  BBS-A-HOLIC [SIT E]  L OS T SOULS DOMAIN [SITE]  THE HELLZONE [SIT E] -BS -  C RI ME RING ][ [SITE]  SOUL ASYLUM [SIT E] [iCE ]  C LO AK N DAGGER [SITE]  THE PALADIUM [SIT E]  M AX IMUM SECURITY [SITE]  THE VOID [SIT E] H OU SE OF THE RISING SUN [SITE] &$ "                                                                                  '           iNSANITY : The Offical iCE Magazine   KP/BS  "Setting the standard of excellence"  [iCE] 3u                  ۲    ۱             ۲                                        ۲             ۲  ۲ ۲     ۲    ۲  ۲   ۲                                                           [ * ]    iNSANITY Senior Staff Black Spyrit Paladin Zodact Genesis   Programmers Lord of Peasants (Head) Camber Kublai Khan  Contributing Members Hyperion Scorch Opus Outland Optical IllusionThe Grim Reaper Einstein Insane Fury                    ۲              .   ۲       .     .     . .    .. .  . ..          . . .           .                                                                                    Sysop: Black Spyrit  (802) 879- 1136 Razor 1911 Courier HQ  iCE World Headquarters - BS - iNSANITY Magazine Home  Rescue Raider Distribution[iCE]*r 514-359-7133 Sysop: 2400-38.4k Mystic Warrior  Celerity/NET                                                                                    -BS-                        [iCE]        &   H I D E O U T   <    9     9     9              4  D        )B     ;      9        )    +   Ansi#Re l ent less=   .[ i CE].) H   ..!.9/i4/9o... 1 G  ) I     !F   >     9          B          <         <     5      "    E   "    D   '  #    >      %   H  . ߲  0     '    G ߰ܰ$     8     #      9          .     >    .    -   >     &   ܰ;      *  ܰ  A           8ܰ            +     =           ;     0    >       (         :      #    5       '     1     <            5    7     ۲۲>  ۲۱߲9۲   =ܱ      ܱE ޲     ޲  A޲  ߱ ۲  ۲  ۲޲  ۲B ۲ ۲  <   ߲ ۲ <  ޱ ۲  <   ۱۲ :    ۲۲  <   ߱۲  <  ۱  ۲   3  ܰ޲   /  ܰ ߰  ۲ 1   ۰ ܰ  ۲ 2       6        6    ܱ     ܱ   9  ܱ   9  ܱ ܱ  ߱  M ۱ ް ۱ L۱    ߱@ ۱۱    > ۱ ۱    > ۰ ۰     ? ۱ ۰ ) ۱  ۱    ޱ ۱ ܲܲ۲M ߰I      0 ۰   E ۱   D   I۱  E ۲   H    :   C H E M I C A L W A R Z O N E7  6 3 5 - 2 2 5 - 4 5 5 5 ADI Beta Home AC/DC Canadian H#ome DnA Canadian Home 200 MBegz On-line  No Ratios MAFiA World % HQ SysOp: The Silent A=ssasin  MarshalALawiCE1ܲ M- a۲INC Dist  200+ Megs  "TCSnet r۲ HST ONLY!  0-7 Day Warez 2߰ s۲ 2 O 1 - 5 3 5 - O 6 5 $5h۲>a۲   : ߰l۲   > ݲ   A۲ L۲     Ma     ,޲ްw     $ ߰    D [ iC E]   ۱  &ܲ ۰& ܱSySop : The Master / ܰ  Cos : Crusher/޲ ߲ܰ  Captain Blood A  Force Ten  A  ܰ ۲M  ܰ C۲  ۰ 5  ۲ ۲ < ۱ ۲ 4  ݱ 9   ۱ ۱۲< M ް ۲=J  ܰ ۰ ۲ 9 K ޱ ۲8۲۲۰=۲ܱ߰1۰ ۲ ۲ ߰۰4۲ ۲ ۲ ܰܰ ۰4۲ ߰۲۲  2۱ ۲ ۲ܰ2۲  ۲ܰ0۱ܲ ޱ۲ -۲۲ ۲ ۲ '۲ ۲  ۲ ) ۱۱  =   0     '  A     'A -H      A              3   T H E  C R I M E  S Y N D I% C A T E  2 O 1 - 5 3 5 - O 6 5 5G {        ܰ ܰ   ܰ  ۰ ܰ  ܱ۰  ۱۱      ۱     ܱ۱   ܱ۰ ܱܱ۲۰ ANSi By: KP <iCE >ܱ۲ Photo For Metallica۲۲ By Gary L. Heard ۲ ߱۲ Total Carnage Systems ۲ ۲ (704)/459-2542 ޱ۲ ߱ 166 Megs of 0-1 Day! ۲ USR HST w/v.42 ߱۲ Velocity v3.053߱ ۲ VelocityNET             ߰   ߰                        ܰ  ߲   ߰     ߰          ܱ ߱ (714)/891-7731 RAZOR 19 11 PC WHQ!! ! < iCE> Di st, PC Expr essAN Si b Y: K P 91 '  "Th e Master"$ ARt: Derek Riggs/KP'iNSANITY CommandsLord of Peasants [iCE]A You don't have to be a rocket scientist to figure out how toAuse iNSANiTY, but I figured I might as well post the commands youuse.= Note that iNSANiTY has mouse support. Cool, eh? PULL-DOWN MENUS( Left/Right Arrow / Left/Right Mouse : . Move between the different main headings." Up/Down Arrow / Up/Down Mouse : 0 Move between the choices in a menu heading.% [ENTER] / Left/Right Mouse Button : Select a menu choice. Esc : Quit from iNSANiTY.ARTICLE VIEWER! Down/Right Arrow / Down Mouse :) Scroll down one line of the article. Up/Left Arrow / Up Mouse :' Scroll up one line of the article. PgDn / PgUp :1 Move down/up one full screen of the article. Home / End :, Go to the beginning/end of the article.! Esc / Left/Right Mouse Button :# Return to the pull-down menus.i                                 ܰ  ܲ ܲ ۲    ܲ۲ ߰ ۲޲ ߲ ۲ ߲߲۲  <iCE> ANSi Requests߲ ݰ   "The best in the business!"  ۰   Don't be fooled by immitators  ݰ     Ask for the best, <iCE> 91' ޱܰ ߰   MISFITS Legacy of Brutality ݱ   add by KP 91' "The Master!" ޲۰ ۰ '۱߰۲                     ܰ    ۲    ߰۲۲  ܲ ߲ ߱ ߲ܲ***********????????????;;;777444000---***&&&### 88=77<66;55;55:44:339339228117117006//6..5..5--4,,3,,3++2**2))1))0((0''/''/&&.&&.%%-$$,$$,##+""+""*!!* ) ((''&%%$$##"!!                       ?=;97531/-+)'%#!   "$&(*,.02468;=?!# &)+.14!!6&&9++<11?  "$&)+-"0$2'4*7- #(.""3..9<~`8`~ngfhjkkjkkjhfd_]dkklmmp|~>(##(C7##2~`~7-))(),--2C~p@p~|tnjjkkjihhffX@>Ziijjlnppnt~~>)$$7~d7$$7h~9/++/H~~pCVhllkjjiihhiihhihS00Shhjnrssrw~~>)%%9|b7%%9~J<2--//-)(()>X~~}}wV59VjnnmllkkV22Shhlsuuy~@+&&5~~y_7&&9~H50036996-(&&<`~~||f@3E[mqqnnmZ50Lbffjqxyyxy~~@+&&+C|q[7&&;h~O@622369;<<;4+%$9h~~|{y{{y{{iL@AQissqqk]]kqq[9,>Xddefmw||{{~~@,((;~pfV5((+C`~dQC944334679972+&9~~||yymVKJObsuttmb[[Q;550&&>duupX97Sbbcdmy~~~7))-|bXL5))<H~O<997643343344677644@~~~{yxxuiZSS[nyyf@)%%$5byyd@7L]aafw~~C/))rZRJ5))p@p~|VH>;;975200357997;CEV|xuuwn]UU]q{{|{b9&&2Vt{{||fC4CV__bm~~C/++9~|bQNE3++>`8`~tVJA<<><><<;752/--/269<hP0PhwbLC@@?@@?<950-,++,-0249>@Q~~yttun_XXbw~~>++Q9>R]]_k~~;,,@XKKD4,,0JphP@(@PhprXBB?;5/,)(())+/4;>?ABBA?;OZ[[dwrJ2--<~VIIC4--;~h`XP@0( (0@PX`hrVDDA<6/)&&(-/3;@BDD@96;J~~wrrsqi_[]k~~>0/00/5rJ~QCD@500C<-&)>p@p~~|yyJOt[LL@-+2><;60,++;[nnmjikmnnmfdciyJ99J~kOEKRUUXi~|tnkV;226QAB>622CyQ@7-($#$/QyH~}{yyxx_77~t]OOD9>ELOOLIGD@<;994-)()9[mmnnmkkmnmmnmhfegr~rJ;;H~wVEIPSS]t~tmkk_E533CtO@A>6336yO>0)&%%)CX~|ywuu_7,t_RRNKNRRQQOKHE@<;97762+&&7Zmmnnmmkhggn~rL<?<633@~ydQC90+(&&(`|wtt_9)>wbSSPKIE>;96553/)%5Xkkmqrrqnlkkjiip~rO@@OrXKKNPRRZr~kccZD6449OrL<><744EyQC;2,)((;h~wrr];+9~wdVVRLJE<97422336;<9632-&2Vjjkmtuutrmjjkkp~QBABBABBALk~|bQLLOPPQSd||i__]O<55HrJ;<;755HydQC5-+))+>~tppqppqppqpp]<-3OwfXXSOE<7620039@JKD<40/+5Viimtyyunkiikmmr|y[GDDGZypXONOOXr|d[[SC766Cd~rJ9;9766HyVE>5/,+,,+,,+,,+,,/C~wpnnm[<00@~wf[[ZVOKE;3/--27;@KRXSI@5/-,9Vhhjpy{{ytkhhjlnnpw~~mQEESy]PPONNQb||bWWXUK<776776776;QJ79977677677HyrVE70--09V|rmmiS;227Qyi]]XJ952-++-5>KQSZ][SE@90,+9Vggmw|{xwwurjgghjnppt~VIIGQmy]RQPNLLVpy_SSNA977JJ77;Q|kVJ@730//026<@ES~~rkkbK9556Hyk__S<,((,57<5,(6Vffluytnkkjgffjnrrw~XKKL_|y]RRPLKKOb||dSPPOG<77JH6677Cd~|rXH;320027CO]fk~~pii]H977C~ymaabaR7+(%%)099>QC23699J}~~}~ZJ>74469>CKV]dknry~~meef[E<LV]ccfpuxy~y]RRSd||bVUQKHHK]|pVKKIA<;;JC0249;;Jr}||}||}yV@976679>CJRZ]dgghny~~kdcddcddcdZH??DXkphhS2$(029JZbhhX>449HZbbdktyy~y_SS[t|bWWRKEEGQm|_LKKJJKID></039<AEOSX]__bm|~yy|kbbZJBBCL_mkk[@5322>Saaiu|{~|bVVXi~|bXXRIEEJ[ymSIIGA<<@@5-/29<<@V~~{yy~pJ;99<@DKORUWWXZ_irkXQ]y|i__ZLEEJXimmib[]fmmlmmid_[SKA60/0;S__acju{{~|bXXb|~i[YSKEDDOk~|]KGGD?>>90,,29>>J~~~{yxx{~pO>;;<>AEKNOOPQRRX]VJA>Lr|f]]ZLHGHHGKSdnnprqnnkdbb[RNKHED<2,-9R__behlqty~|d[[bwwbZXQGCBBCBBCBBCEZymQEEDA?>>?>>;2,+09>>?>>Or~|yxuuwx|~mQA<<>>ACEGGHHIJLLKJHHC><6-)/9??Or~|yuuy~wQA>>?@>?@@AABCDEEDB@>>Lm|i[ZZ[XQLLNVittsnfb]QKJDBBA7,(5O]]bknnrrt~wf__i||f[[SE@@CXyXGDDA@@9-(-9@@Or~ywttw~yXDAA@>97799;>@ABBAA@E_|~iYXYYWRPOOPQZkuurid]OJHA@@?@@?@@?@;/(2O[[]_dpuu||kaafw|f]]VJ@>>J~~kOBBAA;0(-;AAOt~~wtrrty~|[EBBA<3002249;<@BBADVw_WWSRRSZmxxsif]OHE@><<><<><<><<3(0L[[XSV[[VC@Xryyxx{~kddfp~|f]][QC>>AVyXDAABB@6+,;BBDXy~~wtrppry~dKDDC;/)),259@AACDDSy_UUVUUW_p{{yytkff_OHD>;;6+0KZZO>HVZZVC/9t{{~~mffm~~ma__SD<VVC>>@ACDDC9)+;DDQ~~wtrnmmnt~wVGG>35@CDD<-,;DDS~|wrnllmllmllmllmllmr~VIIEBDGIIVwy[OOPSZ]]bdQC@74439LWWVWWL6/;NWWVWWL92Cd~~rmmlr~~kbb_R@779AEEC60KSUSUURH97O~wqqry~~pfee[E9669QQ<997@GGVw~|tnjhhm|y]ONNLNQVXXZdwy]LJJLVaffcZA0--/47;94/--/7KSSOEABIPSSNA9C~ytsttsttsw~ykeebR<44Cd~~kO<779>DHGGHHDCDGGHHK]y~|tmigffgjt~|bROORVX]ippry~~fOHHL[fhhiihhihbS337O~dC66;AGIIHIIHHIIHIIHQm~|rmheefeefn~~iVQRQQRQQRQQRQQRQQSVX]fkpuxy|~pSEEO_kkjbQ7++/36;@ACEE@2))/9CLRRONLLORRNEACSp~|xxy~~nhhX>22@~Q965567@BDDA4(&&(-7dVPPQRQQPPQPPQPKECH[y~{{}~pii[C3005O~@447AIKKJJKKJJKJXtb_bbccb_]ZXVSSQLHC<50@y_SSUUSSUUSUVWX[_bbfikklqyQBBCOdqqnbQD@@BBA7,$$%%+5;;~y[OOPPRRQPOONJGGQm~||~~tkijfQ9//>~O62233;EKKX|]OXaa_]ZXVVSOJE@9776520-)%7|bVVWZ]]_cddfm|tQAALfttspi_RHDAA;-""#(29~y[NNPSSRONNLKKN]t~~|pkkZ;--2J~@006AKLLZmJ@R__[XVVSQLHC>><<><<;96300/00/00//,@|bXXVVWXZ[[]]_k~rO??Liuurkf_SJC@??;0)&27C~wZLLNPSUUVVQLLNNOR_~piik|rllZ;,,-,,-,,-,,--;~5/0//2;GLLPb|wX96K[]][RHCCA><97746O|dZZXVSSVVX]m~rL<<>KiyytmbSJEA><<;69~wZLLPUWW]bVLLNOQQSd|SEEptmm_C/+,,+,,+,,+,,0J~S[[VLHGHGGHGGHGGHGGHGGHGGHGGDEVt~pa]]VLHGGHGGHGGHGGHJJLZr||~rJ;99JirdSHD>;99>QmXJJKOV[[dp_LJJKLPRSVbw~>00@|wqnn[9))-~C0,,2ALOO[y|Z9)%(7OZZXSQOONKQi~yf__]VE@@AADILLQZdiip|O;77CXVE>9779HiVIIJOX[[dwmSIIJJLRSSXdJ2,,-@~tpp[7((<~9++,7HPP[ymH/(&(3JWXXWWSS_w|i__VC97799449Oy]KGGLZ__f|wVGGHLSWW_tr+&&(<~wrrmQ2%%&)/33C~5((+6JRRSd||]C0+))/@PUU[cggedm|`~kdd]H0))-5;;@KVXZ_cddm~C223CVEELZaai|y[JEEIRWYY[fw~2##)Cr~ysst[5$$(/2;HOO[yC+&&/APSSZrL3,++-;LSSYemnnr|X~meecQ<55;HSVZ_deem~C00@~SEEDEEDEEL[bbk|mOEEDEEDEEDEGKRXZZ]iy%!!2~|utt[5""#&/22;HQV]aai|~5%%(6KSS_yC/--6HRRUbpwwy~H~nggf_XVVX_fggm~@//6QSDDL[ddk|SDDELV[[]k~~55~yuub<%!!%-2;JSSV_ddeck|)$$(6KUUSS_y@//4CNPQQRZmy||{{~p@p~piihp~@,,--,+,>d~QCBBCCBCK[eem~yZECCBBCCBCGR[[dw~~{uupX>209JVXbgghr~~2""&2ERUU_yC003@KOOPSdw~~`8`~rkkjp~>++)&$0QyQBBK]ggm~~kOBBDLX]]_iy|xwxxrdZVZdjjmy&%2ERVVXf|H3223;HNNOZp~hP0Ph~tmmlr~))++)((&%$+HrQAAK]ihhn~QAAER]__ak||xxwsnllr~~7ESWW]tO74334339ELLRd|phP@(@Php~wnnr~<(&&()++)),CrO@@?@@J]jjp~yXC@@?@@AKZaa_cp~~yyuqnnt~~SSXXb|S;6659DKKL[yh`XP@0( (0@PX`hyrnppnppnppnppnppnppnppnppnnry@(%%&&())+,-->rO>>?J_llr~~J>>DS_bbiy~|yyxtrrqrrqrrqrqqw~w_XX[i~|]@779AHJJKVrphP@(@Php~uqqrw~rH+%$$%&()++-0022332;[~rL>>H_nnt~rO>>@K[ccem|~|{xttw~yf[ZZY_tkH779>EHHIOb|hP0Ph~ysstsstsstsstsstsstsstsstssw~yV5&""%&))+-23446776;Vy~H<SV@;;<HVbffhr~~~|{yy|~~yi][[]i~Q>;;><>ADDEVw|p_QJEJ_|H~yxxwwxy{{~rZKEESrJ99>CZyykZLC?>>D[|~~{yxwwurnmmljjkt~yi]YYd|~tljjlsx|Q955>Vjnnpw~wf__fwwXGEEDA><<>OryrZJC><<>O~wpmkjihfeeddfp~|k_]][d||qllmqx~~d@447DZknnqw~|mdaak||]KGGC>;;H~ykXLHA<;;Lr~mba__ak~yibbaa_ak~~wpnnrw~C336Hbpprw~|mdbbdp~|bNIID<99>VyyVH@;99Jr|dZZ[]i|~riggffikkp|~trrqrrqrrprr6229779H¡~iXUUV[k~¡ġ|tmlljjmnnry||~á~yutt~>003Hdssty~áá|mfddk~ġà¡¡ ʡtXLLG>77VyɡtZPOOQZp~ǡš~wrqqnnqrrt|~~ϡ|ywwġC/00/00/00/00/0;Xpttu{~ڡ|pfddfp~ˡԡáy[NNJ@766CbVE;667Jrɡ|dQJIIKXwšɡ~yuuttuuw|~~¡¡¡~|yy@//2Hfuuw|š¡|pheekyáš¡ġá¢|bROOLD9449EC9544HǢw[JCCDDGX¢~{yyxxyy|~~¢¢||¢J2--9Xrwwy~¢h¡¢¢~rhffm~¡ĢŢâʢ|dSQQPG933433CʢmL>>??@DLb|Ԣ~~||~~|~~עÒ~;,,-,,-,,-,,-,,-0Hk{yxxy|~â`Ѣ|mgghr~⢢Ģ¢~kZRRSRRSSRJ9227QâyX@97799<@DLQ_w¢£͢~~â£Ģ£Ģ’Õ˜~>+,,+,,+,,+,,+,,;ppruyy{~Xââ|rjhhm|ǢĢ¢¢¢ģãw]SUUSK9002EãQ7223369>EJLQ]m|ƣ¢£¢££££ƣÏÕØ/++2HZ]bkrx{{~H£ã|rkiip~£ģ£ƣ£ˣ|bWVVO<0//Cˣd>-,,--039@HLXr|򣣟ĒØ7)),29HRVX[dmty||~p@pͣ~rkiikt~㣣££¤|dZXXRA2--+,C¤ãJ-&&((+/5<@@Hr|£ã££ƣ¤£Òĕ~<((+7EOSXXZ]dpw{~~`8`ţ¤~tmkkjkkjkkjkkjkkjjp|£ãţȤ~i[ZZVE3++,,++)%,¤~5""%)/7>CQdry䤤ääĤĤäÕʕ~rH,(&((&((&((+09JXZZ[aipw|hP0Ph¤Ƥ~tmkkr~äĤŤΤˤ~p_[[ZL5+))++)(&~ĤǤ759@yƤɤʤФ’ØĘ~5&&)6HRX[[]_bphP@(@PhpĤ~tnllmt~äۤ¥¤yf]]Q9+(())((&&;¤Ĥ~~ĤĤ¥¥ä•ƒĘ¤9%%)0;L[__h`XP@0( (0@PX`hä~unmmr|¥¥¤¥¤¥ĥ¥|i__S<+&&(())++),Cƥƥѥǥȥȥ˜ˆ7$$(6JV]aaphP@(@Phpĥ~wpnnt~ᥥȥ|ka__XC,%%&&()),--5Q¥å¥ɥ¥ĥƥХě‡C(##&/;O_cchP0Phǥ~tnnqw~åɥȥĥ¦~mcbb]H/$$%&))+-/0022>~妥ææĥĒҕ˜ƒˆ~2""&5JX_eef`8`å¥~wrppt~Ħ¦æ¦ŦǦ¦~rfddbQ3%""##$&())+-23345665665664C›č’՘lj¦5!!%-;Obgghnp@pƦ~wrppt~զϦæ|mffeX<(""%()+/3557997JrƦ¦ǦæǦ¦¦’ŏ•Ø˜‡‰‹%$5JZdjiijiijiijiijiihjmr|HƦ~yrqqry~Ħ¦ææǦ¦ħĦ~nhh]H2(()+/5779<<@Xy§çƧ¦Íƒ˜˜˜~9Qfkllkllkllkllkllkklr|~Xç|trru~槦ħ¦§ǧͧ~piibQ>679;<@AA@Jk觧›Ïƕ˜‰§|f_innmmt~ç`Ƨ~wttssx~秧§~rkkjkkjjdRECDDCQtȧ§¨ç¨Ƨ¨Ò•Ƙ‡~wtqppnpt~h§~yutt{§§ǧç¨~wnllmllk_QIHHGEVwĨèĨèĨÒĕ˜˜ˆ¨~~wtrrqrw~èè|rnmmptuux~Ĩ§ĨèèΨ~tnnj[PKKLKKLKKLKKLKKLKKLKKLKKLKKLKKL_|Ψß˨ϒÕʈ‰‹Ő•˜ƨ~~ywuttw~̨~k__bimtuuw|騨èĨ~tppnfXPPOONNQ]tĨߙ¨Ò•Ø„ǍŨ~{wuuy~¨¨y_RRSV[ituuy~ɨĨŨ©©ũ~wqqmbWSSRRSZ]dwƩ™Ò՘Ń戉ŽØ©©ĩ~|{yxyxxy|~ʩwZNNPXitww{Ʃ¨Ʃĩĩȩ~xssrk_XWWVVUUX[_fry~ǩÕ؄ˆÉÐØÕȩũ~~|{{yy|~ϩpVLLNXdmtxxy~ҩȩɩé©|utuurh][[ZZ[_bbitw|~éªÍϏ’ØØăŇĉ‹Õ’©ªé~~}}|{~~êª|_LJJLQZityy{~ééªũȪĪ~yuwupf__]]_dfkw||~~ÏÒҕ’ăˆĉƍ•˜˜’ŪŪȪ~~̪ĪVHHKVityy|ȪªªĪêŪĪª|xxumfccbbaacfiimw|~ĪÒĕ’Õ˜•ň‹Îʕʪͪ~ǪǪwVEEJVdmwyy{~ªϪ˪ªêëªū|yyumhggfeehkmmrwyy|ĕʕØćÍĐŘØĕªīª«ªSDDEDDEHLViw{{|{{~~êū«~{ytnkkjjnqty||~~«Íʘ˜Ã˜ˆÎÒĕÕĒūͫ««~kOBBERiw||~ƫë~}ytnnmnqrrty|~~›Ï˜„˜ĐÕĒ’ÏyXDAADQdpy}}~¬~~yussrrqrttw{||~~’Ē•ƒǘ‹ďÍ¬Ŭ¬rO??BHSiy~~Ŭ¬Ѭ~{wwuuwyy{|~~ìĕ˜ĈÍÕ荒rL<<@Oiy~~ƬǬ~|{yy||~~¬Ï•ĘƒƒÇɘ’›ͬ쬬~H;;>Obp|Ӭ­֬ǭ­~~}~~­›Ò˜˜؈›¬­ɭíì­ĭQ<993//5O˯ůůɯί¯Ø˜ҍÐįƯ߯ǯگï¯ѯ~C2--,,--,,-<~Ưɯïǯί¯¯ˆ…ˆ‰Đ’Õد¯¯¯ïůįïįïįï¯ðð¯~J;/++@¯¯ɯ°°ï°ðͰð‰‹‘ØÕðưаİȰ˰ٰ˰Ȱ~C/))/˰ܰ°°ʰ„͘“؝ͰȰİ°ðǰưɰ˰ð°°İưİ~H5,(&&(&&(7~°ǰҰͰ±Űƒ…‡č•ÕĘϱ±ñ°°ı±İ°ñ±ű°±~@+%%+rıñıӱ„˜Ő•Òĕͱ~>)$$5~񱱲ñıĐÏÒ±Ʊıııñ±ű±ı±±òбññ~C2&!"(ű±˱±±Ų‡ѝ˜ÌÏIJ²±ƲŲDzѲŲDzò˲ƲòIJ~;%!2~²±òIJ±±Ʋ²Ӳ“Ø•ŽÍܲ~5³òóÐŕ˜Õ’Ųв˲³ò³òòò³IJŲ²³òóò²³~~ò³²IJIJòϳÕ˜•’›³ó³Ƴ²ijó³ɳ³ijȳijʳóijó³ijųų³óųƳóijȳƳʳ‘؏ijȳ峳ųֳೳųijóڳʳೳų³´´Ø´ôó´³Ĵ³´ĴɴĴ´´³ĴƴŴóųųôų³´ų´´ij´ƴ̴ÕĘؕȴȴôӴʹƴشѴ˴ʴԴ紴´´ƴôɴ´“؝ՒŴδ˴ƴĴ˴Ĵô´ŴҴɴôĴµŴŴɴ̴Գشµ´µ’•Ęҏĵôõǵµµôõĵõŵȵôŵ´ĵõµƵŰñðıӲôյ•ØØĕƵì̭®ïʰµõĵĵ˜ÕĒǵõ˵Ƶĵĵõĵǵµõĵµĵõĵ¶εµŵµǵöçΩǬ¶¶µ¶ØÒďƶȶõöö¶ǶµŶŶŶõŶ¶¶Ŷµ¶ĶĶµ¶شĶ̣¥æ˧ֶØÕÏČ綶ŲDZȱƶĶ¶Õҍ’·Ķ·¶·Ķ·ö÷·öĶŶ·ŷŶǶ¶¶·Юƭ¶·÷Ƿ·Ò›ŷ¶Ʒ̷···ͷȷķ··¶···ʷ÷Ʒķͷة÷ַѷʷѷӷɷϷϷǷԷ̷··գ·€€Ÿøĸ÷ķ÷¸øøŷ÷·Ÿŷ¸¸·¸ø÷ķ··θƸøѸܸиڸǸѸȸĸ¸ҸŸ¸¸ȸŸøȸʸθĸ¸ø¹¸ŸǸø¸¸иƸǸø¸øŸƸȸE U L ¸¸ø¹¸¹ŹĹùŸʹ¹ǹ¸ǹ¹¹¸¹¸øùù¹¹ù¸¸¸ĸ¸ùøU/LK0/K/KK0湹?RT??ùºȹºùĹι¹¹ùƹ¹ɹǹ¹ŹȹùĹŹº¹ù¹ȹĹƹù¹ºĹOOOO]OŀºĺȺĺźúĺúȺº¹úĺźźƺǺƺººǺźźƺú¹¹aQQQRQR溺SSSaSú€€€ºúºúĻȺ»źúú»º»ºźĺººǺ»º»ºûºúºƺûº\\gg\\º›Ñ»»Żһǻû»ŻĻʻúŻŻŻȻǻ̻º˻ĻûɻŻǻ»ƻlcllcllcllcllc»‘ǻûϻ¼ٻܻ컻ۻjjjjjj“ļ»ļûû¼¼üļ»¼ƻü¼üüû»»üû¼¼»û•¼׼̼ȼż¼⼼ü¼׼ƼļļƼż»Ƽüüм—~~ƼɼȼƼ½üü¼½üɼɼƼ¼½̼ǼɼͼļǼǼ¼üƼü¼¼½¥¼˜Ľɽ¼ýüż¼½Ž½ĽżǽȽ½ýĽýŽüýŽýΩĪý罽̰Ʊý½ƽľȽ½ýɽǽĽʽý½ýýǽɽƽĽȽ½ƽĽȶ˷Ľ›½¾Ǿ¾½ľþ¾¾¾¾½ƾ½¾¾ľ½žƾƾþ¾½¾ýþžľ¾½¾žþž½ɺʻ¼ǽ¾ɦ澾ؽξêԩȬþƾ¿¾ſĿþÿȾ¾¾ľþ¿Ⱦ¿¿¿þ¿ÿžĿžþž¾ž¾ƽ¾þþ¾ÿƲѱȳÿƿǿϿǿǿʿſĿѿĿɿ̿ſÿ¿ȿÿƿĿʿÿſſÿ¾½ú޹ºýĿ???**********???????????? ###&&&***---000444777;;;;;;777444000---***&&&###  ###&&&***---000444777;;;;;;777444000---***&&&###    ! $')!,%/*2#.5(38-7;-7;(38#.5*2%/!,)' $ !     ! $')!,%/*2#.5(38-7;-7;(38#.5*2%/!,)' $ !  *!+#,&-).+/.011203/4-5,7*8)8*8)8*7+6-5.4/302101.0+/).&-$,"+ +*<;;8:4929.8,7)6'6%5"4 43 2 1 1!!!$$$(((,,,000,,,)))%%%"""*('$ "       :>?-7;!17*3 $/+'1 1 1 1' 11 '1 1 1 )0 1 1" 1-?? 1 1 1 1! 1, 11 +1 1 1 ???Ádedeefefeffgfgfgghghhihihiijijjkjkjkklklklkllmlmmnmnmnmnmonononoonoppqppqqrqrqrqsrsststststtututuuvuvvwvwvwwxwxxyxyxyyzyzyzz{z{{|{|{|{||}|}}~}~~~~ÀhiijijijjkjkklklkllmlmmnmnnmononononooponoppopopŀŁÂǃddeeffgghhiijjkkllmmnmnnonoonoonooponppqqqpqpqrqrqrsststtutuuvvwvwwxwxxyyzz{{||}}~~ǀŁłŃńŅÆŇňiijjkjkkllmnmnnonoononoononoppqqÀÃddedeefeffgfgghghghhihihiijijjkjkjkklklkllmlmnmnnonoonoonponoppqqpqrrqrrqrsrsststtutuuvuvuvvwvwvwwxwxwxxyxyxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~~~~ÁÂ􃄃ÄÅhihiijijjkjkjkklklkllmlmlmmnmononoonoponppqǀŁłƒÃddeeffgghhiijjkkllkllmmnmnnonoonppqpqrrqrqrqrrssttuuvvwwxxyxyyzz{{||}}~~~ŀÁǂƒńŅÆŇňhhiijijjkkllmmnmnmnnonoopoppqÀÁÂddedeefefefeffgfgghghghghhihihiijijjkjkklklkllmlmlmmnmnnononpoponHpopoqrqrrqrsrsststststtutuuvuvuvuvvwvwwxwxxyxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~􃄃ÆhihihiijijjkjkjkjkklklkllmlmmnmnonoonoonpopoppqpǀŁłÃddeeffgghhihiijjkjkkllmnmnnnonoonooFFHqqpqrrqrqrqssttuuvvwvwwxxyxyyzz{{||}}~~ŀŁǂĄąņÇÈhhiijjkjkklkllmnmnnonnonoonooppqq’cdcddededeefefeffgfgghghhihihiijijijjkjkjkklklkllmnlmlmmmnmnnoDEFGHpopoqqpqrrsrsrssststtututuuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{z{{|{||}|}|}}~}~}~~~~ÄÆhihihiijijjkjkklklkllmlmlmnmnnonnonpoponoppŀŁĂ҃ddeeffgghhiijjkklllmnmnnonCCEDEFppqqpqrrrsrsstttuuvuvuvvwwxxyxyyzz{{||}}~}~~ÀŁłŃĄÅņ҈hhihihiijjkkllmmnmnnonoonoonopp~Á҃cdcddededeefefeffgfgfgghghghhihiijijijijjkjkkkmmlmlmmnmonoAABCCDEFppqpqrrqrqsrsrsstttututuuvuvuvvwvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{z{{|{||}|}|}|}}~}~}~~~~ÀŃÆhhihihiijijijjkjkjkjkklkllmlmlmlmmnmnnonoonpopoqqÀǁĒccddedeefeffgghhiijjkklllmmnmnn??@ABBDCEEppqqpqrrqrrqrssttuuvvwwxxyyzyzz{z{{||}|}}~}~~ŀ􁂁ÂŃOądž҈hhiiijjkkllmmnmnnonnoonoopon~ÀÁ­cdcdcddededeefefeffgfgfgfgghghghhihihiijijijijjjkkklllmlmlmm>>?@@ABCCDEppqqpqpoOqsrsrstststtututuuvuvvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~~~~~N􇆇ÇghhihiijjijijjkjkjkklklkllmlmlmmnmnmnnonnopoÀŁŒccddeeffgfgghhiijjkkkllmlmn<==>>@@AACBDDonppqpqpNOrqsrssttutuuvvwwxwxxyyzz{z{{||}}~~ŀŁǃMÅņÇhhiiijijjkkllmlmlmmnmnnonnoopop~~ƒcdcdcdcddedeefeffgfgfgfgghghghhihihiijijijjkjkklklklkllm9::;<=>>??@ABCCopoppqpopoNNqqsrsssststtutututuuvuvvwvwvwvwwxwxwxxyxyxyyzyzyzz{z{{|{|{|{||}|}|}|}}~}~~~~~ÀNNghhihiijijijjkjkklklkllmlmlmmnmnnonnoono~~ŀāƒccddedeeffgfgghhiijjjjkkll7799;;<<==??@ABACponppqpopMOOrrqsststtuuvvwwxwxxyyzz{z{{|{||}|}}~~€ŁŃMNÅņŇhhiiiijjkkllmmnmnnonnoon~~~ŀǒbccdcdcddededeefefeffgfgfgghghghhihihihiijijjkjkjkklklk67899:;<=>>?@ABBoponppqpqMMNrrqrsrssststtututuuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{{|{|{|{||}|}|}}~}~}~~~~􀁀ÁELMNÅghghghhih’ijijijjkjkjkklklkllmlmmnmnnonoonoo~~ŀccdcdcddeeffgfgghhiijijjjkkl466788::<;<<>>@@A@BqqppqqpLNNrqrrssttuuvvwwxxyxyyzyzz{{|{||}}~~~~ŀDDFÂÃLMMąÆƇgghh’iijijjkklkllmlmmnmnnonnoo~~~ǒbcbccdcdcddededeefefefeffgfgghghghghhihihihiijijjkjkjkjk344567899::;<==>>?@ABopopoppqpLMLMNrrqsrsrtststtutuuvuvuvuvvwvwwxwxxyxyxyxyyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~DDELL†ghghghhih’hiijijjkjkklklklkllmlmmnmnnonoo~~~~ƀǒbbccddeeffgfgghghhihiijjkj123355667799;:;<==??@@oonpoppqKKMMOrrqrrssttutuuvuvvwvwwxxyyzz{{||}}~}~~~ŀBDDÂKKLLM„Ņ􆇆‡gghh’iijijjkjkkllmmnmnnonnoo}~~~~ǒbcbccdcddededeefefeffgfgghghghhihihiijijijjk/11223455678899:;<==??@oopopoqqppKLKMMqrqsrsrsrstststtututuuvuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{||}|}|}}~}~}~~~BBDJKKLLgghghghhÒiijijijjkjkjkklklkllmlmlmmnmonononoo~~Àɪbbcbccdcddeefeffgghhihiijj/0/112344557688:9;;<<>>??oonopoppKJLLNMqrqrrsststtuuvuvvwwxxyxyyzz{z{{|{||}}}~}~~@BBCBłJJKKLąņ‡gghhÒiijjkkllmmnmnnonno~}~~~êbcbcbcbccdcddedededeefefeffgfgfgghghghhihiijijijij//00112344566788::;;<=>>?oonopopIJKKLLMrrqsrssrsststtututuuvuvuvvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{z{{|{||}|}|}}}~~~~@A@ABCIJJKKL􅆅fgghghghgÒihiijijijjkjkjkklkllmlmlmlmmnmnonoonoo}~~~êbbccddeefeffgghghhihiijijj0/00223344667798::;<==>>oonopoHJJKKMLNrrqrrsststtuuvuvvwwxwxxyxyyzz{{||}|}}}~~~~>@@A@BBÁĂIIJJKK„…džgghghÒhiijjkjkklkllmlmmnmnnonn~}~~~©©abbcbcbccdcdcddededeefefeffgfgfgghghghhihiijijiji.0/0012335567899::;<=>oonpopIIJKLMMorqrrssrsstststtututuuvuvuvvwvwvwwxwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}}~~~~~>??@AABHIIJJK􅆅ÆfgfgghghgÒihiijijijijjkjkjkklklkllmlmlmlmnmnno}~}~~bbccddedeeffgfgghghhiijij/.0/11223355678799;;<<=oonpoGIIJKLKMMqqrqsrssttutuuvuvvwwxxyyzz{{||}|}}}~~=>=??@?AÁ‚IHIIKJKÅƆffgghÒhiijjkjkkllmlmmnmnno~}~}~~~~bbcbccdcdcdcddedeefeffgfgfgfgghghhhihihiijiji.//0/012344556789:9:;<=nonoonooGHHIIJKLLMqqprnsststststtutututuuvuvvwvwvwvwwxwxwxxyxyxyyzyzyzz{z{{|{|{|{||}|}}}~}~~~~<==>??@GHHIIJJ…􆅆fgfgfgghēhihiijijijijjkjkklklkllmlmlmmnmnn}}~~abbcbccdcddedeeffgghhhhiijj-//0011224466788::<<oonFFHHJJKKLLNrrqrssttuuvvwvwwxwxxyyzyzz{z{{||}}~~;<;==>=??Ł‚GGIHIIKń…ĆffgfggŒhhiijjkjkkllmlmnmnn}}~}~~~~~babbcbcbccdcdcdcddededeefefeffgfgfgghghghihihiijij.//0012344667899:;<mnmnnFGHHIJKKMLqrqrrsstststtututuuvuvuvvwvwvwwxwxwxxyxyxyxyyzyzyzz{z{z{{|{|{{|||}}~}~}~~::;<<==>>?ÁFGGHIIJÄ􅆅fgfgfgfghihihiijijijjkjkjkklklkllmlmlmmnmnn}}~~§§abbccdcddeeffgfgghhihiiji-..0/10123355667799;:mnonoonooEFGGIIJJKKMoorqrrssttuuvvwvwwxwxxyyzz{{||}}~~9:9;;<;==>>€ŁEGFGGIHJIKÄņffgfgghhiijijijjkklkllmlmmnmnn}}~}~~~~§abbcbcbccdcdcddedeefefefeffgfgghghhhihihihiij-./.0/01233455678899:omnmnnEFGGHIJKLLMrrqrqsrsrsststststtutuuvuvuvuvvwvwwxwxxyxyxyxyyzyzyzz{z{z{{|{||}|}|}}~899::;;<<==>FEFGHGHIJIÄeffgfgfghihihihiijijjkjkjkjkklklklkllmlmmnmonon}}~~babbccddeefeffgghhii,--//0/112244557788:9mnmnmnnEEFFHHIIJJLLqqpqrnrqsststtutuuvvwwxxyxyyzz{{|||}|}}778899::;;<<==€ŁDFEGFHGIHJĄŅffgghhihiijjkkllmmnmnn}|}}~}~}~~ababbcbcbccdcdcddededeefefefeffgfgghghhihji--.//00122344567788:omnmonononDEFFHHIJKKLLorqrqnsrsrsstststtututuuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|||}|}|}667889::;;<<DEEFGGHHIJÄeffgfgĕhhihihiijijjkjkjkklklkllmlmlmmnmnm}}~~aabbcbccdcddeeffggghhiiii,,..0/00223344667798mnmnonoonBDDFEGGHHIJKKMoorrqrrssttuuvuvvwwxxyxyxyyzz{{{||5566778899::;;<ÀŁDDFFGFHHIHJń…feffgf•hhihiijjkkllmmnmn}|}}~}~}¥åabababbcbcbcbccdcddedededeefefeffgfgfhghhihii,,-..0/001233556789mnmnnonooCCDEEFGGIIJJKLMqqprrsrsrsrsststtututuuvuvuvvwvwvwwxwxwxxyxyyzyzyzz{{z{z{{|{||}3445566778899::;;ÀCCDDEFFGHHIIefefeffgÖhghhihihiijijijjkjkjkjkklkllmlmlmm|}|}}~`aabbccddedeefeffgghghhii,--/.0/11223355678mnmnnonooACCEEFFGGIIJJLKoorqrrssttuuvvwwxxyyzz{{||2233445566778899::;ÀBBDDEDFFGFHHIHÄŅeeffghhiijjkklkllmm}|}|}}~}~}~_aabababbcbcbccdcdcddededeefefeffgfghghhihiiij+,-.//0/0123445567lmmnmnnBBDCDEFGHHIIJKLLqqrqrrrrsstststtutuuvuvvwvwvwwxwxwxxyxyyzyzyz{z{z{{|1122334455667889::BCCDEEFGGHHIIÅefefeff–hghhihiijijijijjkjkjkklklkllmlmlmn||}}_aabbccddeefeffgghhii+,-.-//0012244667mlmmnmnn@BBDDEFFHHJJKKLLoorrqrsrssttuuvvwwxxyyzzz{z{z{{0011223344556677889:;ŀBBCBDDEDFFGGHHIIĄ…eeff¥ghghhiijjkkllmlmmn}|}|}|}}~~_`aababababbcbccdcdcddedeefeffgghghghhiihi*+,-./0/001234456lmnmnnABCBDDEFGGHHIJKKqpqrrqrqrssststtutututuuvuvvvwvwvwwxwxwxxyxyyzz{z{{0/0011223344567678989:ŀAABCCDEEFFGGHHIeefeffåghhihiijijijijjkjkklklkllmlmlmm||}|}}~~__£aabbcbccccddeeffgghhii*+,,-..0/102233556llmmnmn@@AACCEEFGGIIJJpoqporqrqrrssttuuuuvvvvvwwxwxxxxyyzyzz{/.0/001132335455767798ÀAABBCCDDEEFFGGHHIĄeefefågghhiijjkkllmm||}|}}~~~~__`aabababbcbcbcdcdcddededeefefefgghghhhihih*+,-.//0/11233455lmlmlmmnm?@ABBCCDEFFGGHIJqpqporqrrsnstststtutuuuvvvvwwxwxxxyyzyzyzz{z.//0/00112233445576779?@AABCCDDEEFFGGHHdeefefeåghghghhihihiijijijjkjkjkklkllmlmm||~~__aabbcccdcddeeffgghhhhi++,,--//0/1123445llmnmnn??@ABBDCEEFFHHIppqqqqrssssttuuuvvvwwxxxxxyyzz{../.0/10113233545577~À?@@AABBCCDDEEFFGGHĄ…eefågghhiijijijjkkllm|{||}|}}~~~~__`a`aababbcbcdcdcddedeefe¢gghghghih)*+,-..//00122344llmlmmnm>?@AABBCDEFFGHHpoqqpNrrsrsstststttuuuvuvvvwvwvwwxwxxyxyxyxyyzyzz-.//0/011233455677~??@@AABBCCDDEEFGGdedeefe˜ghghghhihihiijijjkjkklklklkllml{||~~__aabbccddeegghhi**++,,..0/0022334llmm=>>@@AACBDDEEGGppqqMNNOrrsssststttutuuvvwwxxyyzz-..//0/10113233556577~>??@@AABBCCDDEEFFńeegghhiijjkkllm|{|{||~}~}~~^_^a`aabababbccdcddededeefegghghhih(**+,,-..0/011233kllmlmlm=>>?@@ABCCDEEFGppqqLMNNOrqsrsrsstststtututuuvuvuvuvvwvwvwwxwxwxxyyzyzyzz{--.//0/012123434565~=>>??@@AABBCCDEEdedeegghghghhihihiijijijjkjkjkklklkll{|{||}}~~__`a`aabbccdcddeegghhi))**+,--/.0/1122llmm<==??A@BACCDEFqqppLLKMNNqqrrssttuuvuvvwwxxNOyyzz,--..//0/10213243546~~==>>??@@AABBDCDDÃĄddee™gghhiijjkkll|{|{|à}}~}~}~~^_^_Ơa`aabab cbccdcddedededeƠgfgghghhi))*++,-.//0/012lkllmlmlm<=>>??@ABBDDEopoppoKLLMMrrsrsrsrsststtutuuvuvuvvwvwvMNNyzyzyzz{,,--..//0/01223445}~~~<==>>??@@AABCDCDdededešgghghghghhihihiijijjkjkjkklkll{{||à}}~~^^__Ơ``aabàccddeeƠfgghh())++,,.-//0012kllmm;<<>>@@A@BBDDEpoppJLLMrrssttuuvuvvJJLLMNyyzz,,--..//00102232445~~;<<>=>>@?@@BABBDƒ„ddeeÚgghghhihiijjkjkklkll{{|{à}|}}~}~}~~^_^_^Ơ`a`a`aabaĠbccdcddedeŠgfgfgghgghh(()**+,-./0/001lklkllm;<==>>?@ABCBDpopopoJKJKLLrrFFGHHIJJKKLMyyzyzyzz+,,--.//00122344~}~~~~;;<<==>>?@@BBƒddedešgfgghghhihiijijijjkjkjkklklkll{{| ||}}~}~^^_``aaĠccddƠffgghh'((**,,--..0/11kkllm;<;==??@@AACCopopopIIKJLqrrs5465778BDDEEFGHGIIJJKLyyzz++,,--.//001022324~~:<;<<>=>>@?@@BB‚ÄddfgghhiijjkkÒ{z{à||}|}}~}~}^_^_^Ơ``a`aabŠbccdcdcddedƠfgfgfgghh''))*+,-.//0/0kklklkll9:;<==??@ABBCoopopoqrqrqrr3446677899:;;<==>??@@ABBCDDEFFGGHIIJKKxyyzyzyzy*++,-.-./0/0011223~}~~~~::;<<=>>?@@cddefgfgghghghghhihiijijijijjkjk’Þ{{ž||}|}}~^^_^ž``aabccddffggghh%''))++,,--//0/kkll::;;<<>>@?@ABoopopqrqrr334465768899;:<<==>>@?AABBCCEDFGGIIJIyyzyz**,+,,.-..0/001122}~}~~99::<;<<>=?>@@AĂǃddffgghhiijjkjž{z{ž|{||}|}|}}~}]^^_ž``a`a`aÞcbccdcdcdcddĞfgfgfgfhgh&'(())*+,-..//kklklkll8::;<<=>>?@AAoopopoppopoprr133445676899:;<;=>>@@AABCCDEEFFGHHIJyxyyzyzy)**,+,,../0/00112~}~}~~~89::;<=<=>?>?cdcddeŜfgfgfgghghghhihihiijijjkžz{ž||}}~^^ž``aažbccdcddÞffgghh&&((**+,,..0kklkl98::;<==>>@@oopoppopoprqrqr11324455768799::<;=<>>??A@BBCDDFFGGHIxyyzz*)**,,../0/001}}~~98:9;:<;=<>=??ŃccddƜffgfgghhiijijijjž{z{|{||}|}|}}]^]^^_^``a`a`bbcbccdcdcddeffgfgfgghghg&'(()*+,--..jkjkklkl899:;;<=>>?@oopopoppoprr0113243566889::;;<==>??@AABBCDDEFFGGHyxyxyyzy)**+,,-../0/00}}~}~}~~7889:;;<==>􂃂cdcdcdȜfgfgfgghghhihihiijijijjkàz{{||}}]]^^``aœbbccddffggh%&''))**+,--/kjkk8799;;<<==??ooppqpopoprqrr011224355668798::;;=<>=??@@BACCDDEEGFǒ(**+*,,-,../.0/0}}~~7799;;<;==>ÁÂăccddžffgghhiijjŸ{{|{|{|{||}|}|}}]^]^]^^`_``žbcbcbccdcdžfeffgfggghg%&&'())*+,,-.jk567899::;<=>>oopopopoppqqrqr0/11224355667898:;;<=>=?@@AABCCDEEFG)()*+*,,-,..//0/Ò}~}~6778899::;;<=ÂcdcdcffgfgfgghghghhihihiijijjŸœ{{||}|}}]]^]^^Ŝ``žœbbccdceffgfgg%%&&(())++,-.244667788::<;<<>ڒ/0/11223354667788:9;;<<>=?>@@AACCDDEFF')(*)+*,,--..//0’55778799:9;;<;āǂƒccdccžffgfgghhihiijjƠ{z{{|{|{|{||}|}}]^]^]^^Ĝ_`_`œœcbcbcbccdÜdƒÒ$%%&'(()**+,-0012344567899::;<==’Ü//0/10223354657=>??@AABBCDDEF'())*++,--../5667889::;;<bccdcžfeffgfgghhghhihihihiijiƠz{{||}|}]]^^œ__``œœbbccœedœ$$%%''((**,,--..0/1123355767799;;<œĠ-//0/1021334?>@?AABBDCE'('))*)++,,--..5565778799::;ÒłccÞffgghhiijĠz{z{z{{|{|{||}|}|\]]^]^]^^œ_`_œ›bbcbcbccœddeÛě#$$%&''))*+,--//0/11233455678899:;<ÜOOǒ.-./0/002BCCDE&''())**++,,--.Ġ445667889::ÜbccfeffgfggghghhihihiijiƠzz{{|{|{||}]]^]^^__`›bbcbccdd##$%&&''))++,+--//00112344657688::;;œLMOppqq,.-/.0/00ȒĠC%''('))*)++,,--3445566778899ʜłccžeffgggghhiizz{z{z{z{{|{||}|}|\]\]]^]^^`_abbcbcbddedš##$%&'(())*+,-..//00122344567788::;ÒnJKLMoppopopr+,--/.0/0sststtututu˒ǒ&&''(())**++,--į23445667889bcbcbžefeffgfg hghhihiiji jzz{z{{|{||]]^^š_`ښbbcbddšÚ"$$%%&&((**++,,..0/00223354667799::’nnFHHJILppqq*,,--..0ssttutuuvuvvwwxxyy%&%''(())**++,,2233445566778žÂcbccĠfeff ghhihiikyzyzz{z{z{{|{||\]\]]^]^š_š™ÚabbcbccdcddeÚÚ""#$%&'((**+,--..0/01123355667899:nnDEFFHJJoppqpqpq+*++--.rsstststtutututuuvuvvwvwvwwxwxwxxyxy$%&&'(())*++,011223344556677ÒbcbcbĠefeffgfg hghghhihihiijyyzz{z{{||]\]]^^™_bbdcddeš!##%$%&''))**+,--/.0/1122335567879mmCBEFGHHopopp)**,+--.ssttuuvvwwxx$%%&&''(())**,+.0/00112233445566€‚bbccĠŸeeffàghghhiijjyyzyzyzz{z{z{{|{|{||\]\]\]]^]^]bbcdcdcdd˜Ē"!"#$%&''())*+,,-.//0012344556789lmmnnACCEDFpoppopo()**,+-,rsststststtututuuvuvuvvwvwvwwxwxxyxy$$%%&&''(())**++,--./0/0011223344556􀒞ÂbbcĠd deefeffghghhihihjjyyzyzz{{||\\]\]]^Ø`abbccdd’ff ""$#%%&&(())++,-.-//001224466778mmnmm@AABEDopopp')(**++-sststtutuuvvwvwwxwxx#$$%%&&''((*)**,,..0/001122334455Á‚bbceeffgghhiijyyzyzyzz{z{{|{|{|{\]\]\]]^]^]ØĘ`babaccdcdcdde’eefefeffg ""#$%&&'(()*++,-.//00123446678lmlmmn=?AACCpopopp''((**+rsrsstststtututuuvuvuvuvvwvwvwxwxxy##$$%%&&'(()**++,,--..//0011223354~žabbc dƠeefef¢ghghghhihi£jiyyzyzz{{|\\]]Ř``bb˜ccdcdcddeeeff!!#"#$%%''((**,,--..0/1123355767llmm;>=@?ABoopp&'')(*)+rrsststtutuuvvwwxx"##$$%%&&'(()**,,../.0/101132335~~Ÿ‚bbĠcdee£gghh£ijyxyyzyzz{z{{|{|{\\[\\]\]]^]^Ř_`_ababcbccdcddedededefef !!"#$$%&''))*+,-./.0/0123345567lmlmlmm:<<=??opopopopp$%&&''(*)rsrsrsststtut=>wxwxwx""##$$%&&'()()*+*+,--.//0/0011223~~ŠÁabbĠdceefef¢hghghghhijixyyzz{{|\\]]——__``Ęaabcbccdcddeeeeff "!##$%&&''))++,,--//0011224465llmm8:;<=>oopopp$$&%''((rrsstt799::<;=wwxx!""##%$%%'&'')(**+*,,-,../.0/101133~~Ġābbcc¢eeģgghhiijyxyxyyzyzyzz{z{z{{|{[\[\\]\]\]]^Ř`_`_`Ęabbcbccdcddededefefef !""##$%&'(().//001223445llmlmlm88::<=oopopopo#$$%%'&'rrsrsrsstst668898:;;wwxwx!!""##%$%%'&'()()*++,--.//0/0112~~~Šababcc¢edeegghghghijixxyyzz{{|\\]]^__`_`abbccddeeeff! ""$$%&&.0/00223354llmlmm678::<oopopop##$$%%'&rrsrsstt1224355667798::;ww !!#"##%$%%''))*++,,--..//0/102~~Šāaabbccãdeegghh˜iiyxyxyyzyzyzz{z{z{{[\[\\]\]\]\]]^__`_`_b•bbcbcbccdcdcddedeeefef !!""#$%&ihiij..0/011233klkllmlmlm56788:oopop!!""#$$%&rrsrsrsstst11223354667898:vwvwwxwx !!"##$%%*++,--..//0/01}~~~~Ġaba£bcbcãdedfgghghgh˜ijixxyyzyzz{{[[\\]\]]Õ^__``ĕabbcbccddeeefe!!##%$%hhii-//0/11224kkllmm354789oo !!#"$$%%orrss/10223354667788vvww! !!#"##%%zz{*++,,--..//0/~}~~~~Áaaccãed¤gghg˜iixxyxyyzyzyzz{z{z{{[\[\[\\]\]\]]_^_^__`_`ĕabbcbcbccdcdcdcddeeeefef "!"#$%hhihihi-.//00123klkllmlm135576oop !!"$#$rrsrsst0/102334565788vwvwvwwx !!"#$#%zz{z*++,,--..//~}~~~~ ā£Ããde¤ågfgghgh¥hiixxyxyyzz{{[[\\]\]]Õ^^__``•babbccddee ""$#%hhii-.-//00122kkll123347nnoo !!""$#oorrss/0/10213344657vvww ! "!#"$#yzz{{*++,,--..//}}~~~ddfgg¥iixwxxyxyyzyzyzyzz{z{z[\[\[\[\\]\]\]Õ^_^_^__`_ĕabbcbccdcdcdcddededeef ! ""#$hhihi,-./0/0012klklklkllm0/1335oo !!""rrsrsst/.0334455vvwvww  !"!"#yzyzyzz{z*++,--./}}~}~~~~£‚ƒ¤dØ¥gfgfgghihihxxyyzyzz{z{[[\[\\]]^^_^__`_aabbccddee!!#"$hh,--..0/112kkll/0/233oo ! ""oorrsst132445vvwvww ! ""#yyzz{**++,,.-.}}~~~£d¥e¥gghhixwxxyxyyzyzz{zZ[[\[\[\\]\]]Ò^]^^_^_^__`_`aabababbcbcbccdcdcddeddee !!##hghhihi+,-.//0/1kjkklklkll./0/11oo !oorrsrststt113245uvvwvwvw !""yzyzyzz{z)**,+,,.-|}|}}~~}~~~~£Ă˜efgfgghhihwxwxxyyzz{[[\[\\]]’]]^^__`ǒaabbccdcdcddee "!#hh+,,--//00jkkll,./0/2nnoo! oorrsssstt0011224vvww ! "yyzz*)**,+,,|}}}}~~~£ØeeØgfgfg˜hhxwxxyxyxyyzyzyzyzzZ[Z[[\[\\]\]]^]^]^^_^__`_ǒaabababbcbcbccdcddeded !""ghghhi*+,-..//0kjkklkll,,./0/mnnmqqrqqrrqsrsrsststs/0/1122vuvuvvwvw !!yyzyzz()**+,,}|}}~}~}~}~~~Ă¥Ħee¦gfgghhihwwxxyyzzZZ[[\\]]]]^^__Œaabbccdde! "hghh*++,,..0/jkjkklkl)*,,.-0nns.//0/11uvvww !yyzz((*)**,,||}}~~¦¦edeffghhwwxwxxyxyxyxyyzyzyzzZ[Z[Z[[\[\[\\]\]\]]^]^]^^_^_^__`Œ`aabababbcbcbccdcdded !!ghghh**+,--..0kjkjkklklk()**,..mnnon,..//1vuvuvvwyxyyzyzyz'(()**+||}~}~}~~~Àåł¦dedeffgfghghhwwxxyxyyzzZZ[[\\]]^]^]^^__’``aabbccdd !gghh)+*+,--//jjkkl'&)*+,,mnno !!""$#%%&&(')(-,.-//0/uuvvxyyzz&(')(*)+*||||}}~}~~¥À¦æddee§ffggghhwwxwxxyxyxyyzyzzZ[Z[Z[[\[\[\\]\]\]]^]^^_^_^__`_Ò``a`aababababbcbcbccdcdd ghghgh))*+,,-./jjkjkk#%'')(*,mnn !!"##$$%&''((**++,,.-//0tuuvuvuvvxyxyyz&&'()()*{||}}|}|}}~}~}~~~~¥€å¦dededffghghhwwxxyyzzZZ[[\[\\]]^^__’``aabbcbccdd gghh(*)++,,.jjkjkk#$%%&)(+mqnn !!""##%$&&''((*)++,,.-/.uuvvxxyyzy%'&'')){||||}}~}~~ddedeffgghghwvwwxwxwxxyxyxyyzyzyZZ[Z[[\[\[\\]\]\]]^]^^_^_^__`’``a`aababbcbccdcdcdd fgghgh(()*++,-ijjkjkjk"!#%%''(mnnmn !""#%$%%''(*)*+,,-/tutuuvuvvxxyxyxyyz%&&''()|{|{|}|}|}}~}~}~~~¦‚cddedffghghgwwxxyxyyzZZ[Z[[\\]]^^__```aabbccddgghh'((**,,-jijjkk"!$#%&'mqnmnn! ""##$$&%''(())+*,,--uuvvxxyy%%''('{{|||}}~~~¦ÂbddffgghwvwwxwxwxwxxyxyyYZYZZ[Z[[\[\[\[\\]\]\]]^]^^_^_^___``a`a`aabababbcbccdcdcdcfggh''))**+,ijijjkjkjk !##%%'nmnn !!"##$%%'&'())+*,+-tututuuvuwxxyxyxyy#$%%&&'(|{|{|{|}|}}~}~~~~Ł‚b¨dcddedefffgghgvwwxxyy_`_``agg&&''))++,iijjkk !"#%%mqnmm "!#"$$%%'&(())**,+utuuvxxyy$#%%&%'{{{|||}|}}~~Ább©ccdd©fgghwvwvwwxwxwxxyxyxy`_`_``a`aafgfgg%&'((*)*+ijijjkjk !"##mqnmm !""#$$%'&''))*,tututuuvuxwxxyxyxyx#$$%&&{{|{|}|}|}}~}~}~~~Ł‚bb¨cdcdcddedŪgfggvvwwxwxxyy__``agfgg%&&((**+iijj "#mqnmm!#"$#%%&&('))**ttutuuwxxy"#$$%%&{{|{||}}~~Ábbccdcdde©fgfggwvwvwvwwxwxwxxyxyxy__`_``fgfgg$%&'(()*hiijijjkjk "mlmnnonpononoppopo##$%&&')(*ttutuuvuwwxwxxyxyx""#$$%z{z{{|{||}|}}~}~}~}~~Łbbcdcdcddeªƒgfgfggvvwvwwxwxxyy__``aaffgg$%%&''))+iijjlmmnnnnoonoponppop$#%$&&'')(ttutuuwwxx""##$$%zz{{{{|{||}}~}~~€Ábbccddffggvvwvwvwwxwxwxxyxyxy_^__`_`_^ffgf#$%&''())hiijijijjkmlmlmmnnoonnoononopoppqqrrqrq$&&'(sttutuuvwwxwxwxxy!!""##$$z{z{{{|{|{||}|}|}}~}~}~}~~ÀƁbabccddʒffggvvwwxx__`aabffg$$%%&&((*iijjmlmnnoonoonoonopoppqqrrqqrrq%''ttuuwwxx !!""##zz{{{|{||}}~~Àabbccdcdcddedfgfgfgfvuvvwvwvwvwwxwxxyxy_^__`_`_effgf"#$%&&'((hiijijijillmlmlmlmmnmnnonoonponopoppqqrrqqrrqsrssttututvwwxwxwxwx !!""#zz{z{z{z{{|{||}|}|}|}}~}~}~~ŀābabccdd¬ffgfguvvwvwwxx^__`ff#"$$%%'')ihiijijkllmnnmnnonnoonoopoppqqrrqqrqrrssttwwxwx !!""zz{{||}|}}~}~~¨aabbcbccdcdcdcddeǒeffgfgfvuvuvvwvwvwwxwxwxxy_^_^__`_^effgf!##$%%&''hihiijijikklklkllmnnmnonoooonpopoponpopqqrrqqrrqsrsrsststtutuvwvwwxwxw !!"zyzzz{z{{|{|{||}|}|}}~}~}~~©ǀaaba’bbccddĬffguvuvvwwxx^^__`ff"!##$%&&'hhiijkkllllmnnonnoopooppqqrrqqrrssttvvwwx! !yyzz{{||}|}}~}~~©aa’bcbcbccdcdcddefeffgfvuvuvvwvwvwwxwxwxwx_^_^_^__eefeff ""#$$%&'hihihiijijjkjkklklklklmlmmnnonnnnnopppqqrqrrqrrsrsststststtvvwvwvwwx yzyzyz{z{{|{|{|{||}|}}~}~~ǀaababbccdccddƒeeffguuvvwwxwxxXXYY]]^^__`_``cbcceeff! ""$$%%&&hhiijijjkklllmlmmnmmnnonnoonpnpoqoorqrrsrssttvvwvww yyzyzz{z{{||}}~~aabbabbcbcbccdcdcddefefeffuuvuvvwvwvwwxwxwxxXYXYX]]^]^]^^_^_^__`_`_``cbcbcceefefe !!"##$%&'ihihiijijijjkjjkklklklkllmlmmnnonnonoonpponqqorqrrsrsststsvvwvwvwwyzyzzz{z{z{{|{|{||}|}|}}~}~}~ŀa`aabbccddĒeeffuuvuvvwwxwxXXYY]]^^__`cceef !!##%%&hhihiijijjjjkkllmmnmmnnonnoonooqpqooorrqrrsstvvwvwwyyzz{{|{||}}~~Ē~ǀÁbababbcbcbccdcddĒeefefeffutuuvuvvwvwvwwxwxwXYXYXYX^]^]^]^^_^__cbcbcceefefe "!"#$%&hhihihihiijijkjjkklklkllmlmlmnnmnnoonpopqpoppqpqqrrqqsrsrsststsvuvvwvwwxyyzyzz{z{z{{|{|{||}|}|}}~}~ĒaabbccddeefeffuuvvwvwwxXXYXYY]]^]^^_^__bbcceef ""$$%%hhiijjjkjkklkllmnnmnnoonooqpqpppoqqrrqqrrsstsuvvwyyzz{{||}}~~ŀÁbabababbcbcbcbccdcddedeefefeutuuvuvuvvwvwvwwxwWXXYXYXYY]]^]^]^]^^_^_^__babcbcbccedeef ! ""#$ghghhihihiijijijjkjkklklkllmlmlmlmmnnonnoonpopqpoppqqqrrqqrrssrsrsststsvuvuvvwvyxyyzyzyzz{z{{|{||}|}|}}~}~}Ò~aababbcbccdddeefefuuvvwvwwxXXYY]]^]^^__abbbcbccdee!!##gghhiiiijjkjkkllmmnmmnnoonoonooppqqrqqrrqrqrssttuuvvyxyxyyzz{{||}}~~~ÀaabababbcbcbccdcdcedeefefeutuuvuvuvuvvwvwwWXWXXYXYX]]^]^]^^_^_^bcbcbcbcedede !!hghghghhihjijijijjkjkklkllmlmlmlmmnmmnnoonponopoppqpopoqqorrsrsrsrsststsvuvuvvwxyxyyzyzz{z{z{z{{|{||}|}|}|}}~}~’~~~ÀaabbccddddeeftutuuvvwwXWXXYXYY]]^]^^_aabbccdedee "gghghhhihiijjkkllmlmmnnonnoonoopoppqppqqrqrqrsrsssttuuvvxxyyzz{{||}}~}~~ŀa`aabababbcbccdcdcddedededeeututuuvuvuvuvvwvwvwwxwxxyya}}~~āŃededegfgghghghhihhiijijijjkjkjkklklkllmlmlmmnnoonoonooponopoppqpqqrrosrsstststtuuvuvvxxyxyxyyzyzyzz{z{z{{|{||}|}}~}~~~~À`aabbcbccdcdddedeetututuuvuvuvvwvwvwwxwxxyxyxyxc}}~}~}~~~]ddedfgghhiijijjkkllmlmlmmnmnnonnoopopoqppqqrqqrrssttuuvuvvxxyyzz{{||}}~~~ŀa`a`aabbabbcbcbccdcdccddededeettutuuvvwwxwxxyxyc}}~~]Á‚ăddedegfgfgfggghhihihiijijijjkjkjkklklkllmlmmnnmnnoonpopoppqpqqrrqqrrqsrsstststtutuuvuvwxxyxyyzyzyzz{z{{|{|{||}|}|}}~}~~~~~Ā`a`aababbccdcddeetututuuvuvuvvwvwvwwxwxxyxyxyxc}}~}~}~~]、‚􃂃cddffgghhiijjkkllmnnmnnoonopoppqpqpopoqpqqrrqqrssttuuvxxyyzyzz{z{{||}}~~ŀa`a`a`aababbcbcbccdcdcddededeettuuvuvvwvwwxxyxyc}}~}~€ŁÂƒdcdcddeeffgfgfgghghghhihiijijjkjkjkklklkllmlmmnmmnnoonoopoppqpqpqqrrqqrrrssstststtutuuvuwxwxxyxyxyyzyzyzz{z{z{{|{|{|{||}|}|}}~}~}~~~~``aabbccddeettutuuvuvuvuvvwvwwxwxwxxyxyx}}}}}}~}~}]]ccccddeffggfgghhiijjkkllmmnnmnnonoonpopqppqqrqqrqrrsstttutuuwwxxyyzz{{|{||}}~~À``a`a`aabababbcbcbccdcddededttuuvvwwxxy}}cc}}~]]c€Ł􃂃ccdcdcddeefefeffggghghghhihihihiijijjkjkjkjkklklkllmlmmnnonnoonpopqppqqrpopoqrqrrsrrsststtutuuvwvwvwwxwxxyxyxyxyyzyzz{z{{|{|{||}|}|}}~}~}~~~~``a`aabbcbccdcddeststtututuuvuvuvvwvwvwwxwxwxxyxyyc}}}}|}}􃂃ccddeefffgghhiijjkklkllmmnnonnoonooppqqrqqrqqrrqqsststtuuvvwwxxyyzyzz{{|{||}}~~`_```aabbababbcbcbcbccdcddedttuuvuvvwwxwxxyxyc}}c}}}}ÀŁccdcddeefefefffgfgghghghhihihiijijjkjkklkllmlmlmmnmmnnopopoqonppopoqoqqrrqqsrsststtutuvuvvwvwwwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~_``a`aabbccddeststtutututuuvuvvwvwvwvwwxwxwxwxxyx}}}}}}}|]]ŀbccdcddeefffgghhiijjkkllmmnnonnoonpopqppqppqqrqqrqrqssssttuvuvvwwwwxxyxyxyyzz{{|{||}}~~ƀŁÂŃdcddedssttutuuvuvvwwxxy}}}}}]]ŀŁ‚cbcbccdcdededeefefeffgfgghghghhihiijijijjkjkjkklkllmlmlmlmmnmnnoonooponopoppqpqpopoqrqqrsrsrsrsststtuvuvuvvwvwwxwxwxxyxyxyyzyzyzz{z{z{z{{|{||}|}|}|}}~}~}~}~~~cddstststtutututuuvuvvwvwvwwxwxwxxyxyx}}}}}ccdddedeefeffgghghhihiijjkkllmmnnoopoppqqrrsssttuuvvvwwxxyyzz{{||}|}}~}~~ŀÁłădcdcddssttuuvvwwxxyǀÁ‚bccdddedeeefeffgfgfgghghghhihihiijijijijjkjkjkklklkllmlmlmmnnonnonopopopoppqqrrqqsrsrsststttutuuvuvuvvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{||}|}|}}~}~}~~~~Âccddststststtututuuvuvuvvwvwvwwxwxxyxyx~ÀÂccbccddeeffgghhiijijjkkllmmnnonoopopoppqqrrqrrqssttuuvvvwwxwxxyyzz{z{{||}}~}~~ŀŁǂƒdcdcdcsststtutuuvvwvwwxwxxǀŁ‚bbcbccdcddededeefeffgfgfgfgghghhihiijijijjkjkjkklklkllmlmlmmnnonoopoopopoppqqrrqsrsrsstststtututuuvvwvwyyzyzyzyzz{z{z{{|{|{||}|}|}}~}~~~~~ccdrsstststtututuuvuvuvuvvwvwvwwxwxwxxyxyx~Ácccddeeffgghhiijjkkllmmnnoopopoppqqrrqrrssttuuuuvvyyz{{||}}~}~~~ÀŁłccdcdcsststtutuuvvwwxx~~ŀdcdcdeghhihioopopoppopoprrqsrsstststtutuuuvuvy{z{{ခccdrsrsststtutuuvuvuvuvvwvwvwwxwxwxxyx~~~dcddeehhoopopprrqrssttutuuz{{€Łłccdcrrssttuuvuvvwwxx~cddeghhihinnonoppqqrrsrsststststtututuzz{zÀbccdrsrsrsstststtututuuvuvuvvwvwvwwxwxwxxyx~}~~~ddhhoopprrqrrsststtutuzz{cÀŁÂcbcbccrrsrssttuuvuvuvvwwxxy~~ddeghghhinnonoprqqsrsrsstststtutuwxwxwzz{zbccrsrsrsstststtututuuvuvvwvwvwwxwxwxwxx~}~~~~abddgghh~oopqqrrssttwwxxzzĀÁ‚cbcbccrrqssttuuvvwwxx}~}~~babaddegfgghghghgcjijjkmlmlmoopopqqsrsrsrsstststvwvwwxwxwxxyzz{z{z{z|}}~}~}~}ÀÂbccbcrrsrsstststtututuuvuvvwvwvwwxwxwxx}~}~}~~~恀aabbddedfgghiijjllmlmmnnonorrqrrsrsststtvvwvwwxxzz{z{}}~~ŀŁ‚bbcbccrrqrrssttuuvvwwxwxwxx}}}~~aababacddegfgfgghghgiijijijllmlmlml~onno~rqqsrsrsrsstsuvvwvwvwwxwxwxxyzyzz{z{z}|}}~}~}~~Ábbcrrqsrsststststtututuuvuvvwvwwxwxx}}~}~~aabbddffgghiijijjllmlmmnnonqqrrsrsrsstuvvwwxwxxyzz{}}~~ĀŁ‚bbcbcbrrqrrssttutuuvvwvwwxx|}}~~Āaabababddegfgfgfgghgihiijijijlkllmlmlmmooqqrrsrsrsstvuvvwvwvwvwwxwxwxwxxzyzyzz{z|}}Ábbcqqrrsrsststtutuuvuvuvvwvwvwwxwxxyx}|}|}}~}~~aababddffgfgghhiijjkllmmnnoqqrrssuuvuvvwvwwxxyzyzz{||}|}}~ÀŁbbrrqrrssttuuvvwwxx|}}ŀa`aababadcdffgfgfgfgghghghhihihiijijlkllmlmmnnqqrrsrssuuvuvvwvwvwwxwxwxxyzyzyzz{z}|}|}}~~ÀÁbbqqrrsrsrsstststtutuuvuvuvuvvwvwwxwxx||}|}|}}~}}`aab~ddffgfgghhiiklkllmlmmnnpqrrqrrsrsuuvvwwxxyyzyzz||}}~~ÀƁbababbqqrrssttuuvvwwxx||}}Àa`a`aabab}cdcfeffgfgfgghghghhihihihiijlklklkllmlmmnnoqqrrsr|utuuvuvuvvwvwvwvwwxwxxyxyxyxyyzyzz{||~~~~Àabbqqrrsrsrsrsstststtututuuvuvuvvwvwvwwxwxwxx||}|}|}}`a`aabaddeffgfgghhihiikkllmmnnoooqqrrsctuuvvwvwwxwxxyyzz}~~ŀābababbrqqrrsrssttuuvvwwxx}||}}|€a`a`a`aab~dcfeffgfgghghghhihihihikklklkllmlmlmmnnpoprrqrrsrutuuvuvuvuvvwvwvwwxwxwxxyxyxyyzyzy}~~~~~aabbrqqrrsrsrsstststtututuuvuvuvvwvwvwwxwxwxwxx{{|{||}|}|}||``a`aadcccefeffgfgghhii|kkllmmnmmn~orrqrrtuuvvyzz}~~~ǀaababaqqrrsrssttuuvvwwxx{{||}|c€``a`a`aabccdcfefefeffgfgghghghghhihihikklkllmlmlmlmmorqqsr~ttutuuvuvuvuzyzy|}}~}~~~~aabqqrrsrsrsstststtutututuuvuvvwvwvwwxwxwxx{{|{|{||}|}||~``aaeeffgghghhihiijkklkllmmnqqrr~~ttuuvvyyz}}~~~ǀaababaqqrrsrssttuuvvwwxwxx{{||}~``a`aabab|eefefeffgfgfgghghghhihihikjkklklkllmlmlmlrrqrrstututuuvuvuyyzy}}~}~}~~~~aabpopoprrqrrsrsststststtutututuuvuvvwvwvwvwwxwxwxx{{|{|{|{||}|~_``a`aaeeffgghghhih~~jkkllmqqrrttuuvuvyy{{||}}~~~ŀa`aabappqqrrqrrsststtutuuvvwvwwxwxxz{{|{||}|`_`_``a`aabccedeefeffgfgfgfghhikjkjkklklkllmlmorqrr}utututuuvuyyzy{|{|{}}~}~`aapopoprqqrrsrsstststtututuuvuvuvvwvwvwwxwxwxx{z{z{{|{|{|{||}~_``accdeefeffghh}jkkllnnonooqqrrttuuvvxxyy|{{||}}Àa`a`aappqqrqqrrssttutuuvvwwxxzz{{|{||~`_`_``acbcedeefefeffgfghhi~~kjkjkklklkllnnonoorrqrr}tututuuvuvuvxxyxyxyy{{|{||}}|}}~`a`aapopoprqqrrsrsrsstststtutuuvuvuvuvvwvwvwvwwxwxxzz{z{z{{|{|{||~_``bbccdeeffhhjjkkllcmmnnooqqrrttuuvv}xxyy|{{|}}~€a`a`a`ppqqrqrrqrrssttutuuvuvvwvwwxxzz{{|{||~__`_``bbcedeefefeffhghhjjkjkjkklklklmmnnonnqqrrtututuuvuvuxxyxyxz{{|{|{|{|}|}|~~``a`aoppopoprqqrrsrsrsstststtutuuvuvuvuvvwvwvwwxwxwzyzz{z{z{{|{|{||}~__`_bbdeefghhjjkklmmnnonooqqrrutuuvwxxy|{{||~~€``a`a`ppqqrqrqqrrsrsststtuuvuvvwwxyzz{z{{|{||炁‚ededeeghghghjjkjkjkklmmnnonoooqqrtuuxwxxyxyxz{z{{|{|{|~~~~``aopoppopoprqqrrsrsrsrsststtututuuvuvuvvwvwvwwxwxwxwzyzyzz{z{z{z{{|{||}|~~~あggjjkmmnnorqrwxx~~~``a`poppqqrqrqrrqssttuuvvwwxwxyyzz{{||‚gghjjkjommnnnqqrwwxw~}~~~~~_``aopopoppqqrrsrsrsstststtututuuvuvvwvwvwwxwxwyyzyzyzz{z{z{{|{|{|}|ggjjkmmnnoqqrrwwx}}~~`_`_``popoppqqrqrqrrqssttutuuvuvvwwxyyzz{{||~fgfgjjkjnqnnonooqrrqsrsvwwxw}~}~}~~~~_``opopoppqqrqrqrrsrsststststtutututuuvuvvwvwvwwxwxwyxyyzyzyzyzz{z{{|{|{|{||}|}瀁ffggjjmmnnoorrqrrsrsvvww}}~~~`_`_``oopoppqqrqrqrrsrssttuuvvwvwwxxyyzyzz{z{{||}}Àaffgfgjijjmmnnoorrqsrsrssuvuvuvvwvwvwwxw|}}~}~}~}~~~_``opopopoppqpoprrqrrsrsstststtututuuvuvuvvwvwvwwxwxxyxyxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}ccddedeefeffgghhiijjkkllmmnnonooppqqrqrqrrqssttuuvvwwxxyyzyzz{z{{|{||}}~}~~~__`_``oopoppqpqqrrssttuuvvwvwwxxyyzz{{|{||}}~~ÀŁłccdcdcddededeefefeffgfgfgfgghghghhihihiijijijjkjkjkklklkllmlmlmmnnonoopopoppqqrqrqrrsrsrsstststtututuuvuvvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~__`_`opopopoppqqrqrqrrsrsrsstststtutuuvuvuvuvvwvwwxwxxyxyxyxyyzyzz{z{z{{|{|{||}|}|}}~}~}~~~~ŀあccddeeffgfgghhiijjkkkllmlmmnnnnonooppqqrqrqrrsrssttutuuvvwwxwxxyyzz{z{{|{||}}~~ooppqqrqrqrrsststtutuuvvwwxxyyzz{{||}}~~ŀŁÂbccdcdcdeeffgfgfgghghghhiihijjkjkklmmnnnnoopopoppqqrrsrsststtututuuvuvvwvwvwvwwxwxwxxyxyxyyzyzyzz{z{{z{{|{||}|}|}|}}~}~}~~~~~nnonopoppqpqqrrsrsrsrsstststtututuuvuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{{|{||}|}|}}~}~}}~~~~ccccddddedeeeeffgfgghhhiiijjjjkkllmmnnnnooopopppopopprrqrrsststtuuvvwwxwxxyyzz{{||}|}}~}~~~ooppqqrqrqrrssttuuvvwwxxyxyxyyzz{{||}}~~~ǀÁ‚bbcccdddedeefeeffgfgfgghghhihiijijjjkjkjkklklklllmlmlmmnnonnonoppqqprorrqsrsstststtututuuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{{z{{|{|{||}|}|}}~}~}~~~~~~nnonopopoppopopprqqsrsrsrsstststtututuuvuvuvvwvwvwwxwxwxxyxyyzyzz{z{z{z{{|{||}|}|}|}}~}}~}~~~~ÀÂbbcccdccdeeeffgfggghhiiijjjjkklklllmmnmmnnoooonppqqrrrrsssttuuvvwwxxyxyyzyzz{{||}|}}~}~~~nnonoopoppqqrqrqrrsrssttuuvvwvwwxxyyzz{{||}}~}}~~ǀŁ‚bcbcccdcddeefeefeffgfghhghhhijjjkjkjkjkklkllmlmlmmnnonnnnopoqpqqnonsrssstststtutuuvuvuvuvvwvwwxwxxyxyxyxyyzyzz{{z{{|{|{|{||}|}}}~~~~~nnonopopopoppqqprrqrrsrststtutututuuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{||}|}}~}~~~Ábbcccdddeeffggghghiiijjkkkllmmmmnnoooopnqqqorssttuuvuvvwvwwxxyyzz{z{{||}}~~nnonoopopoqqrrtvvwwxxyyzz{{||}}~~ŀŁ‚bcbcccdcdddedeeefefffgggghghihiijjijjkjkkklkllmlmlmlnnonnnoopopppqrrqrsrsrsrsstststtututuuvuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{{z{z{{|{|{||}|}|}}~}~}~~~~nnoopopopoqtvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{||}|}}~}~}~}~~~Ábbbcccdddddeefeffgggghhhiijjkkkkllmmmmnnoopppqrqqrrqrqrrsststtuuvuvuvvwwxxyyzz{{|{||}}~~nnonnonoopoqqpoqqrqsttuuvvwwxxyyzyzz{{||}}~~ÀŁabbccbccddedeeefefefffgfghghghihiijijijkjkkjkklkllmlmlmlmmnnooopnqpqqpqrsrsrsststtututuuvuvuvvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{{|{|{||}|}|}}~}~}~~~nnonoopopopoqqrqrsrsstsutuuvuvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~~~ÀÁbbbccddeefeffffgggghhiijjjkllmmmmnnnnooppoqoqpqrqrsststtuuvvwwxwxxyxyyzz{{||}}~~nnonoopoqppoqrrqrsrstttuuuvvwwxxyxyyzz{{||}}~~ÀƁababbcbcbccdcdcdcddededeefefeffgfgfgfgghghghhihihiijijijjkjkjkklklkllmlmmnnonoopopoppoqqpoqqprqrrqsrsstststtututuuvuvvwvwvwwxwxwxxyxyxyyzyzz{z{{|{||}|}|}}~}~}}~~nnonoonnpoppqrrqsrsrstsutuvvvwvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{{|{||}|}|}}~}~~~~Àaabbccddedeeffgfgghhiijijjkklkllmlmmnnmmnnmnnonoopoqqppqpqqpqqrqrqsrssttutuuvvwwxxyyzz{{||}}~~mmnnmnnonooppqqpqqrqrsstuuvvwwxxyyzyzz{z{{||}|}}~}~~ŀāababababbcbccdcdcdcddedeefefegfgfgghghghhihihihiijijjkjkjkjkklklklkllmlmmnnmnnonoopoqqppqpqqpoqqprqrqsrsstststtututuuvuvuvvwvwvwvwwxwxxyxyxyxyyzzyzz{z{z{z{{|{||}|}|}|}}~}}~}~~nmmnnoopqpqrqrrqrsrsstsuuvuvvwvwvwwxwxwxxyxyyzyzz{z{{|{|{||}|}|}}~}~}~~~~~aababbccdddedeeeeffffghhihiijijjkkllllmmmmnnonnonoonopopppqqpqrqrrqtsttuuvvwvwwxwxxyyzz{{||}}~}}~~mmnnonnonooppqqpqqrrqrrssuuvvwwxwxwxxyyzz{{||}}~~~ǀ`aabababbcbcbccdcdcdededefeeffgggghghhihihihijijjkjkjkklkllmlmmmnnonnonpoqqpoppqqpqrqrrsrsstststtutuuvuvuvuvvwvwvwwxwxwxxyxyxyzyzyzz{z{z{{|{||}|}}~}~~nmmnnonnooppqqrqrrqrrsststtuuvuvvwvwwxwxxyxyxyyzyzyzyzz{z{{|{|{|{||}|}}~}~~~~aabbccdcdcddeeeefeffgggghhhiiijjkkllllmmnqnnoopppqqprqrrqrsststtuuvvwwxxyxyyzz{{||}}~~nmmnnonnooppqqpqqrrssttuuvvwvwwxxyyzz{{||}|}}~~~ǀ`aabababbcbcbcbccdcdededeeefefeffghghghhihjijjkjkklmmlnnnpnnpopoppqqpqrqrrsrsrsststtutuuvuvuvuvvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{||}|}}~}~}~nmmnnonnooopopqrqrrrssttutvuvuvvwvwvwwxwxxyxyxyxyyzyzyzz{z{z{{|{||}|}|}}~}~}~~~~aabbcbccdcddeeffgghhhiiijjjjkjkklllmmmnnopnnonooppqpqrqrrssttuuvvwwxxyyzyzz{{||}}~~mmnnmnnonppqqqrqrsssttuuvvwwxxyxyyzz{{|{|{||}}~~~ŀ`aabababbcbcbccdddeedeefeffgghghhiihijijjijkjkklkllmmllmmoopopoqqppoqqpqrsrsrsstststtututuuvuvuvvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~mlmmnnonnoppruvuvuvuvvwvwwxwxxyxyxyyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~a`aabbcbccdddeefffgghghhhiiiijjjkkllllmmnnonnnnonpopppoqqporrqrrqssttuuvuvuvvwwxxyyzz{{||}}~~lmmnnonppqqruuvvwwxxyyzz{{||}}~~À`a`aabababbcbcbccddcddeededeeffggfgghhhhhiijjiijjkjkklklqllmmonnonpoqqppoqqporqrrsrsstststtutututuuvuvvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{{|{||}|}|}}~mlmlmmnnopoppqprtuuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{||}|}|}}~}~}~~~``aababbccdddeeefeffggghhhiiijjjkkkllllnmnmnnnonoonpoqnpqqpqqqrsststtuuvvwwxxyyzyzz{z{{||}|}}lmlmmnnonnooppqqpoqqpoqrqrrsrssttuuvvwwxxyxyyzz{z{{||}}~}~~€`a`a`aabababbcbcbccdcdddedefefffggfghghhhiijijijkjkklklllmlmmnonnonoopopoonqonqrqrrsrsstststtututuuvuvuvvwvwvwwxwxwxxyxyxyyzyzz{z{{|{|{||}|}|}}~nlmlmmnnmnnoopopoqqppqpoqqpoqrqrrsrsrsstststtututuuvuvuvvwvwvwwxwxwxwxxyxyyzyzz{z{z{z{{|{||}|}|}|}}~}~}~~~~``aababbccddeeffgfgghhiijijijjkkllmlmmnnonnoopopoppoqqpoqrqrqrrsrssttuuvvwwxxyyzz{{||}}llmmnnnnoppqpoqrsstttuuuvvwwxxxxyyzyzzz{{||}}~}~~€`a`a`a`aababbcbccdcdcdcddedeefefeffgfgfgghghghhihihiijijjkjkjkklklklkllmlmmnnonnoopoppqpqqprqrrqsrsststststtututuuvuvuvvwvwvwwxwxxyxyxyyzyzyzz{z{{|{|{|{||}|}}llmpmmrooqqsststuuvvvwwxwxxyxzyz{z{z{{|{|{||}|}|}}~}~}~~~~``aabbccddeeffgghhiijjjkkllmmnnonnonooonppqqpqpqrqsststtutuuvvwvwwxwxxyyzz{{||}}llmqmmnnoooqqqprqsssttuuvvvwwxxxyyyyzzz{{||}}~~~_``a`a`a`aabababbcbcbccdcdcddededeefefffggghghhhihiijijjkjkjklklkllmlmmnnonooopponpoqpqqpornsrsststtutuuvuvuvvwvwvwwxwxwxxyxyxyxyyzyzyzz{z{z{{|{|{||}|}lkllqnnnoopqrqpqrsttstutvwvwvwxxyxyzyzz{z{{|{|{|{||}|}}~}~~~~~``aabbccdcdcddeeffgghhhhiijjjjkkkllkllmmqnnonoqnoqnppppqpqqqqrqqssttuuvvwwxxyxyyzz{{||}}llnnnoonnqpqrqrtsttuuvwvwwxxxyzzz{z{{|{||}|}}~~_`_``a`a`aabababbcbcbccdcddedeefefefefggghghghhihihiijijjjkjkkmlmlmmmmnnoooppoqppmpoqqporqrsrsrsststststtutuuvuvuvuvvwvwwxwxxyxyxyyzyzz{z{z{{|{|{||}|}lkllmqnnnnoppppqqrqrstststtvwvwvxyxyyxyzz{z{z{{|{|{|{||}|}|}}~}~}~~~~__``aababbccddeeffffgghiiiijjjjkjkkllllmmmnnonooppqqpoqqrqrrssttuuvvwvwwxxyxyyzz{{||klllmmmnoooqpprqrqrrssstuuuuvvwwwxxxyyzz{{|{||}}~~~_`_`_``a`aabababbcbcbccdcdcddededeefefeffgfgghhhihiiijijjjkjkklklmlmllmnnonnooonnppqpoqqrqrrsrsrsrsstststtututuuvuvvwvwwxwxwxxyxyxyyzyzyzz{z{z{z{{|{||}lklkqlmmnnooopoppqpqrrsstttuuuvvvwvwvwxyyxyxyzz{z{z{{|{|{||}|}}~}~}~}~~~__``a`aabbccddeefffffgghhiiiijjkkllllpnnnnonopoppqqoqqpqqrrsrssttuuvuvuvvwwxxyxyyzz{{||klkllmmnnooppqqprrqrstttuuvwwxyyzyzz{{|{||}}~}~~~_`_`_`_``a`aababababbcbcbccdcddededeefefffgfgghghhiiijijjijjkkkkklllmmlmmnnonnoonponoppqqoqpqqrsrsrsststtututuuvuvuvvwvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{{|{||}lklkllmlmlmmnnonoonpoqqpoqpoqqpoqrqrqrrsrsrsstststtutuuvuvuvuvvwvwvwwxwxwxxyxyxyyzyzyzz{z{z{{|{|{||}|}|}}~}~}~}~~~__``aababbcbccddedeefffffggghhiijjkkkkllllmmmnornnoooopppqpqooqpqqrrssttuuvvwwxxyyzyzz{z{{||kkllmlmmnnmnnonnonoopoppqpoqqpoqrqrrqrsrsststtuuvuvvwwxxyxyxyyzz{z{{|{||}}~~^__`_`_``a`aababbcbccdcdcddededeefeeffgfghhhihiijjkjkkllklmlmlmoqmmnnopoqpoqqpqqrrsrsrsstststtututuuvuvvwvwvwwxwxwxxyxyyzyzyzz{z{z{{|{|{|kklkllmlmlmlmmnnonoopopoqqppqpqpqqprqrqsrsrsrsststtututuuvuvuvvwvwvwwxwxwxwxxyxyyzyzyzyzz{z{z{z{{|{||}|}|}|}}~}~}~~~~__`_``aabbccddeeffgfgghhiijjkkllmlmmnnmnnonoopooppqqpqpqqprqrqrsrssttutuuvvwwxwxxyyzz{z{{||#The Official Story on USA/FairlightGenesisA On September 12, 1991, a new crack group was formed - USA.A From the moment the idea of this group was conceived to theA moment when we put out our first release took around twelveA hours. In this short time span a lot of phone calls were madeA while members, dist sites and couriers were inducted,A strategies were planned, a management staff was formed, andA the USA name was created. USA stands for United SoftwareA Association. It is a totally generic group name, we agree,A but when we formed USA in this short time we already had aA release in hand and wanted to get it out quickly, so we didn'tA spend a whole hell of a lot of time thinking about what toA call ourselves. Plus we liked the catchy three letter comboA of USA so we went with it. The "USA" title just has a way ofA growing on you, so even if you don't like it now, give it someA time, you will get used to it. I think we spent all of aboutA a half hour on deciding the group name and spent the rest ofA the twelve hours on more productive things. The name of aA group isn't what makes the group anyway, it's what the group6 releases that counts, as I'm sure you'll all agree.A USA's senior staff consists of The NotSoHumble Babe, Silencer,A and myself. There is no president or dictator in this group.A There are just three senior staff members who all consult oneA another and reach an agreement before making any decisions.A The primary organizer of USA is The NSH Babe, formerly knownA as The Humble Babe. The NSH Babe had been with THG for quiteA a long time and I won't go into details, but as a result ofA some conflicts of interest within THG, The Humble Babe andA about 10-15 other members, member boards and distributionA sites were removed from THG. Why did THG drop so many peopleA at once? I really don't know the TRUE reasoning behind thisA decision, but I will not speculate on the rumors I haveA heard. It happened, and that's that as far as I amA concerned. But, whether it was justified or not, I did notA find it too cool the way the situation was handled. This,A coupled with other factors led me, a few others and most of) the couriers to quit THG and join USA.A When deciding to join USA in the early hours of the birth ofA the group, I saw that they already had a top-notch list ofA members and boards behind them, and a great amount of ambitionA and determination to become one of the best. I was offered aA Senior Staff member position in the group, and since I had aA lot of experience and ideas which I felt could be used to helpA USA excel in their endeavors I felt that this would be a greatA opportunity to get involved. The challenge of starting aA crack group from the ground floor and making it a realityA appealed to me. It would be hard work, but with the effortsA of our talented and diversified list of members I knew we could go far.A As it turned out, there was a Euro Amiga Group trying to breakA into the American PC Scene about the same time as USA wasA forming. This group is known as Fairlight, and its founderA and president is Strider. We hooked up with Fairlight and weA are basically acting as Fairlight's PC Division, but with anA identity and management staff that is all our own. StriderA will be supplying us with Euro-PC originals once in awhile,A and trying to set up more PC contacts for us in Europe.A Strider has already come through with a couple of games forA us, 7 Colors and The Immortal, and is working on many more.A Fairlight has been around for many years and Strider startedA it back in the old C-64 days. It is a group that has beenA going strong on the C-64 and Amiga scene for quite some timeA now, and should be doing well on the PC scene once things get set up.A USA's first release was Spellcasting 2o1 Beta. We got a lotA of feedback about this ware, some good and some bad. TheA pirate world seems to be divided 50/50 when it comes toA betas. About half of the comments we received were pro-beta,A the other half were anti-beta. We don't really see a problemA with releasing beta wares. We make every effort to depict theA ware as being a beta, such as with the Spellcasting release weA put a B in every filename, we put a BETA in every fileA description, we named the .nfo file S201BETA, and we wrote aA paragraph of explanation in the nfo file as well. This wasn'tA enough for some people, apparently, because once the wareA started getting spread by non-USA couriers, some peopleA uploaded it without putting BETA in the file descriptions andA this pissed a few people off after downloading it, thinking itA was a release and then finding out it was only a beta. All IA can say is that we have nothing to hide, we went out of ourA way to show everyone that S2o1 was Beta, and those who do notA pay attention to filenames or take a brief moment to do a zip6 view on a file shouldn't feel like they were duped.A USA's second release was some documentation for SpellcastingA 2o1 Beta, and our third release was a Demo of the latestA upcoming SSI game, Shadow Sorcerer. I think it's interestingA to see a sneak preview of a new and long-awaited game via aA demo and I especially like playable demos. A lot of times weA get demos of wares we are expecting to put out so we'll putA the demo out to give people an idea of what the game will beA like. This way people can decide whether or not it will beA worth their time to download the game when it does come out.A Not many other groups seem too interested in putting demosA out, perhaps they think it's lame or cheezy. But we're goingA to try it for awhile and if we get a good response we'll= continue, a bad response and we'll quit putting demos out.A Our fourth release was our first major release - Might AndA Magic ]I[. We got off to a slow start with a beta and a demo,A and I'm sure a lot of you said "Shit, I bet betas and demosA are the best they can do." Well if you were one of thoseA people I'm sure the MM3 release was quite a pleasant surpriseA for you. We enjoyed putting it out and by doing so, hopefullyA we proved ourselves to the pirate world that we are not someA fly-by-night organization. And if that didn't convince youA well then I'm sure the next release, Leisure Suit Larry 5A did. This has been one of our largest and most popularA release to date, but still, the fact that we released it# uncracked caused a few problems.A The problem with Larry 5 is that it had one of the mostA difficult copy protection schemes ever put into a game.A Sierra has a notorious reputation for making difficult toA crack copy protection, and this release was no exception.A We've heard that practically every major group, INC, THG, PEA and TRSI/TDT were trying to crack this and no one was able toA until 4 or 5 days later when this dude Eldar from VisionA Factory put out a nice little crack for the game. I'd like toA congratulate Eldar, by the way, for his excellent work on thatA crack. It was really a great achievement and earned him someA well-deserved recognition. We would have liked to have him onA our team but he was recently picked up by Razor 1911, IA believe. In any case I think he's a great cracker and I wish< him luck in his endeavors with whatever group he chooses.A In the meantime while everyone was waiting on a crack, SCD-DoXA put out some scanned doc check codes for Larry 5 which enabledA most people to play the game through. Most people realizeA that Sierra copy protection is a total bitch to crack, andA have been quite understanding of why we put it out uncracked.A A few people made a big stink over the uncracked Larry 5, butA they didn't know any better. No group will sit on a ware forA 4 or 5 days trying to crack it, while knowing some other groupA is just going to put it out uncracked anyway. With a game asA large as Larry 5 it takes 4 or 5 days to get thoroughA distribution anyway, so what is the point of waiting. We'reA better off getting the ware out to the public, getting creditA for the release, and then working on the crack. If you don'tA agree with that, well I don't know what to tell you, exceptA that's the way it is and has been for quite awhile. We'reA just playing by the same rules that have been established forA years, and that's, 'He who gets it out first wins'. If aA group would hold a game like LSL5 for 4 days while crackingA it, or release a game like LSL5 right away, but uncracked,A then put out a crack 4 days later, what is the difference?A You get the cracked game at the same time either way, don'tA you? At least in the case of a huge Sierra game like LSL5A being put out right away, you at least have time to downloadA it and distribute it while waiting for the crack to be put out. It makes sense.A We followed Larry 5 with some dox and hint releases, thenA Wordtris, then a couple of Euro games, 7 Colors and TheA Immortal. Then we put out some more pretty huge games, PoliceA Quest 3 and Willy Beamish. Police Quest 3's protection wasA integrated as part of the game play, and made it notA worthwhile to crack, for to do so would probably ruin the wayA the game was intended to be played. Willy Beamish had a docA check at the near-end of the game. Fortunately we were ableA to put out a patch for it before anyone even discovered theA doc check. It seems that these game companies, especiallyA Sierra and Dynamix are getting more and more clever with theirA copy protection schemes with each new release. People areA going to have to learn to be a bit more understanding withA crack groups due to these increasingly difficult copyA protection schemes. Sometimes these games will have to beA fixed, or won't be able to be cracked at all, but you can beA sure the games will be followed up with some form ofA documentation to get you past the protection. Hey, it's freeA software, so why bitch about it? Crack groups do their best,A and are only human, and we should respect and understandA that. There's one thing you can count on, though, we have 3A very experienced and well-known crackers in USA: R. BubbaA Magillicutty, Lord Blix and Harry Lime. When we releaseA games, they go to our crackers first, and if it's not someA crazy Sierra protection or a doc check at the end of the game,A the ware will be cracked before we put it out. We'veA successfully cracked every non-Sierra game we've put out, so, cracking is not a problem for this group.A Well that's about it as far as what we've put out since USAA was created less than a month ago. For being around for suchA a short time we think we've done pretty well, and we'll hope you agree.A Another thing about USA is that we won't knowingly orA intentionally double release another groups ware. There haveA been a few instances where we have received our copy of a gameA only a few hours after another group had released their ownA version of the ware. The two times I can recall thisA happening were with Millennium 22oo and Corporation U.S.A Version. When we get a new ware we check a few of the topA boards to make sure it has not been released yet. If it hasA been released we will not double release it. We will justA settle for putting out the dox instead, as we did with both ofA these wares. Y+The Official Story on USA/Fairlight (Con't)GenesisA I'd like to introduce all of our members to you now andA explain what we all do at USA/FLT. The members of USA/FLT are0 grouped into four classifications as follows: USA Senior Staff Members ~~~~~~~~~~~~~~~~~~~~~~~~A The Senior Staff Members basically do a little bit ofA everything from supplying new wares to helping couriering theA wares to our dist sites. Senior Staff has many, many dutiesA and responsibilities, and oversees the release of a new wareA from beginning to end. We are basically all on the same levelA of power, and we are all "in charge" of the group. There isA no president or ruler of the group. The senior staff membersA all try to discuss things together and make joint decisionsA together on all things which affect the group. The basicA premise of USA is "group effort" so we all work togetherA towards common goals. The Senior Staff Members consist of the following people:A The NotSoHumble Babe - Organizer of Dist Sites, Members,. Wares, Supplies.? Silencer - Organizer, Packages, Liaison on Euro contacts.@ Genesis - Organizer, Editor and Chief of USA-DoX, Packages, Supplies.8 Strider - Prez of Fairlight, Euro contact/supplier. USA Regular Staff Members ~~~~~~~~~~~~~~~~~~~~~~~~~A The regular staff members are actually by no means "regular"A or "ordinary". They are the backbone of the group; fromA suppliers, to crackers, these members do a great deal to helpA make it all happen. Without these guys, USA wouldn't be much of a group at all: Lord Blix - Cracker Suicidal - Head of Couriers Harry Lime - Cracker Static - Organizer2 The Necromancer - Loader coder, USA-DoX Scanner" R. Bubba Magillicutty - Cracker Mad Gib - Supplier The Guch - Coder Lord Sterling - Supplier Snuggles - Supplier USA-DoX Team ~~~~~~~~~~~~A The USA-DoX Team members supply, type, scan, and create doxA and solves for our games as well as others. These guys helpA make the pirate ware experience complete with full dox and$ solves for your reading pleasure:A Genesis - USA-DoX Team Chief Editor, Supplier, Packager, Coordinator" The Necromancer - Scanner/Typer% Repo Man - Scanner/Typer, Supplier+ FAThead - Game Solver and QwikDox writer Current Couriers ~~~~~~~~~~~~~~~~A Couriers are the unsung heroes of the pirate community. TheseA are all of our current couriers responsible for spreading ourA releases to our dist sites and member boards and beyond.7 Without these guys, USA wares wouldn't get very far:8 Morpheus, The Bartender, Crime Slave, Snuggles,6 Dr. Crippen, Heavy Metal, Live Wire and CrossA We've received a great public response to our new group andA have been getting many membership, courier and dist siteA applications. We are being picky about who we select to be aA part of our group, ensuring that only the very best people areA accepted into our family. We are not interested in being theA biggest group, we just want to be one of the best. If youA feel you have something to offer to our group, as a courier,A supplier, or cracker, then give our VMB a call or contact oneA of the Senior Staff Members via CelerityNet. We are always onA the lookout for talented and dedicated individuals who are interested in joining us.A I hope you will appreciate my openness and honesty in thisA article. Perhaps the article is a bit lengthy, but at leastA now you know who we are, what we do and how we do it. It'sA USA's belief in an open-door type policy and being in touchA with the pirate community that has allowed me to be soA forthright in this article. With the continued support of allA of you, our friends in the pirate world, we will be dedicatedA to being around for a long time. Thanks for supporting USA/Fairlight-PC.Competition in the Mag WorldLord of Peasants [iCE]A Greetings... With the release of iNSANITY #1, a lot ofApeople starting talking about what was the "best" mag around.)Some said iNSANITY, some said SCD, etc. A The result of people's proclamations of the "best mag" wasAthat some people who are members of one mag group or another Adecided to get pissed off if their mag wasn't the one that peoplewere saying was the best.A In this article, I'm going to address the useless:"competition" between the several mags that are out there.A First off, I'd like to say that the competition is reallyAvery stupid. What need is there for competition between twoAmags? It's not like someone is going to have to choose betweenAdownloading two mags and thus, will only download the "best" one.=Most people read all the GOOD mags, not just the "best" one. A I don't know if I'm conveying my point, but what I'm sayingAis, why compete when there is no need to think of your mag as theA"best"? Let the people decide who has the best mag. Just keepAyour mag good, and people will read it, even if they don't regardit as "the best".1 ...LoP...